ProGP456

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP456
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 83332
Genome Sequence(s)
GenBank NC_000962.3. 
EMBL CP009480 
Gene Information
Gene NameRv2164c
NCBI Gene ID 887217
GenBank Gene Sequence NC_000962.3
Protein Information
Protein NameProbable conserved proline rich membrane protein (MT2222)
UniProtKB/SwissProt ID O06213
NCBI RefSeq NP_216680.1
EMBL-CDSCCP44941.3
UniProtKB Sequence >tr|O06213|O06213_MYCTU Membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2164c PE=1 SV=1 MRAKREAPKSRSSDRRRRADSPAAATRRTTTNSAPSRRIRSRAGKTSAPGRQARVSRPGP QTSPMLSPFDRPAPAKNTSQAKARAKARKAKAPKLVRPTPMERLAARLTSIDLRPRTLAN KVPFVVLVIGSLGVGLGLTLWLSTDAAERSYQLSNARERTRMLQQHKEALERDVREAASA PALAEAARRQGMIPTRDTAHLVQDPDGNWVVVGTPKPADGVPPPPLNTKLPEDPPPPPKP AAVPLEVPVRVTPGPDDPAPPARSGPEVLVRTPDGTATLGGATHLPTQAGPQLPGPVPIP GAPGPMPAPPLGAVPSPAPAENPVPLQVGAAPPAGLPGPAPVAATPGLSGGSQPMVAPPA PVPANGEQFGPVTAPVPTAPGAPR
Sequence length 382 AA
Subcellular LocationMEMBRANE
Glycosylation Status
Glycosylation Type O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT252
Glycosite(s) Annotated Protein Sequence >tr|O06213|O06213_MYCTU Membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2164c PE=1 SV=1 MRAKREAPKSRSSDRRRRADSPAAATRRTTTNSAPSRRIRSRAGKTSAPGRQARVSRPGP QTSPMLSPFDRPAPAKNTSQAKARAKARKAKAPKLVRPTPMERLAARLTSIDLRPRTLAN KVPFVVLVIGSLGVGLGLTLWLSTDAAERSYQLSNARERTRMLQQHKEALERDVREAASA PALAEAARRQGMIPTRDTAHLVQDPDGNWVVVGTPKPADGVPPPPLNTKLPEDPPPPPKP AAVPLEVPVRVT*(252)PGPDDPAPPARSGPEVLVRTPDGTATLGGATHLPTQAGPQLPGPVPIP GAPGPMPAPPLGAVPSPAPAENPVPLQVGAAPPAGLPGPAPVAATPGLSGGSQPMVAPPA PVPANGEQFGPVTAPVPTAPGAPR
Sequence Around Glycosites (21 AA) AVPLEVPVRVTPGPDDPAPPA
Average Amino Acid Composition around Glycosite(s)_VT(he)PGPDDPAPPAR_
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionLC-MS (HCD)
Technique(s) used for Glycosylated Residue(s) Detection HCD
Glycan Information
Glycan Annotation Hex
Literature
Year of Identification2014
Year of Identification Month Wise2014.1.31
ReferenceSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess. "O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins." Journal of proteomics 97 (2014): 296-306.
AuthorSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA
Corresponding Author Sonja Hess.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA