ProGP457 (LppO (Putative lipoprotein))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP457 (LppO (Putative lipoprotein))
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 83332
Genome Information
GenBank NC_000963.3
EMBL CP009480
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelppO (Rv2290)
NCBI Gene ID 887203
GenBank Gene Sequence NC_000962.3
Protein Information
Protein NameLppO (Putative lipoprotein)
UniProtKB/SwissProt ID P9WK71
NCBI RefSeq NP_216806
EMBL-CDSCCP45072.3
UniProtKB Sequence >sp|P9WK71|LPPO_MYCTU Putative lipoprotein LppO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lppO PE=1 SV=1 MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATVMVEGHTHTIS GVVECRTSPAVRTATPSESGTQTTRVNAHDDSASVTLSLSDSTPPDVNGFGISLKIGSVD YQMPYQPVQSPTQVEATRQGKSYTLTGTGHAVIPGQTGMRELPFGVHVTCP
Sequence length 171AA
Subcellular LocationMembrane
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT73, T75, S77, S79, S81, T83 and S84
Glycosite(s) Annotated Protein Sequence >sp|P9WK71|LPPO_MYCTU Putative lipoprotein LppO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lppO PE=1 SV=1 MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATVMVEGHTHTIS GVVECRTSPAVRT*(73)AT*(75)PS*(77)ES*(79)GT*(81)QT*(83)T*(84)RVNAHDDSASVTLSLSDSTPPDVNGFGISLKIGSVD YQMPYQPVQSPTQVEATRQGKSYTLTGTGHAVIPGQTGMRELPFGVHVTCP
Sequence Around Glycosites (21 AA) CRTSPAVRTATPSESGTQTTR TSPAVRTATPSESGTQTTRVN
PAVRTATPSESGTQTTRVNAH
VRTATPSESGTQTTRVNAHDD
TATPSESGTQTTRVNAHDDSA
ATPSESGTQTTRVNAHDDSAS
Average Amino Acid Composition around Glycosite(s)_T(he)ATPSESGTQTTR__TAT(he)PSESGTQTTR__TATPS(he)ESGTQTTR_TATPS(he)ESGTQTTR__TATPS(he)ESGTQTTR_TATPS(he)ESGTQTTR__TAT(he)PSESGTQT(he)TR_
ProGP Web Logo
Technique(s) used for Glycosylation DetectionHCD, ETD, CID, LC-MS
Technique(s) used for Glycosylated Residue(s) Detection HCD, ETD, CID
Glycan Information
Glycan Annotation 1 or 2 Hex between 73, 75, 77, 79, 81, 83, 84.
Literature
Year of Identification2014
Year of Identification Month Wise2014.1.31
ReferenceSmith GT, Sweredoski MJ, Hess S (2014) O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins.J Proteomics, 97:296-306. [PubMed: 23702328]
AuthorSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA
Corresponding Author Sonja Hess.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA