ProGP458

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP458
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 83332
Genome Sequence(s)
GenBank NC_000962.3. 
EMBL CP009480 
Gene Information
Gene NameRv1887
NCBI Gene ID 885247
GenBank Gene Sequence NC_000962.3
Protein Information
Protein NameRv1887
UniProtKB/SwissProt ID O07745
NCBI RefSeq NP_216403.1"
EMBL-CDSCCP44653.1.
UniProtKB Sequence >tr|O07745|O07745_MYCTU Membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1887 PE=1 SV=3 MDTVLGLSITPTTLGWVLAEGHGADGAILDRNELELHSGRNAQAIHTAEQLAAEVLLAHE VAAAGDHRLRVIGVTWNAEASAQAALLVESLTGAGFDNVVPVRRLRAIETLAQAIAPVIG YEQIAVCVLEHESATVVMVDTHDGKTQIAVKHVCRGLSGLTSWLTGMFGRDAWRPAGVVV VGSDSEVSEFSWQLERVLPVPVFAQTMAQVTVARGAALAAAQSTEFTDAQLVADSVSQPT VAPRRSRHYAGAAAALAAAAVTFVASLSLAVGIQLAPHNDTGTAKHGAHKPTPRIAKAVA PAVPPPPTVTPPVPARAPRPAAQHEPPARVTSGEALTEPNPPEEQPNASAPQQDRNDSQP ITRVLEHIPGAYGDSAPPAE
Sequence length 380 AA
Subcellular LocationMEMBRANE
Function unknown
Glycosylation Status
Glycosylation Type O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT308 and T310
Glycosite(s) Annotated Protein Sequence >tr|O07745|O07745_MYCTU Membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1887 PE=1 SV=3 MDTVLGLSITPTTLGWVLAEGHGADGAILDRNELELHSGRNAQAIHTAEQLAAEVLLAHE VAAAGDHRLRVIGVTWNAEASAQAALLVESLTGAGFDNVVPVRRLRAIETLAQAIAPVIG YEQIAVCVLEHESATVVMVDTHDGKTQIAVKHVCRGLSGLTSWLTGMFGRDAWRPAGVVV VGSDSEVSEFSWQLERVLPVPVFAQTMAQVTVARGAALAAAQSTEFTDAQLVADSVSQPT VAPRRSRHYAGAAAALAAAAVTFVASLSLAVGIQLAPHNDTGTAKHGAHKPTPRIAKAVA PAVPPPPT*(308)VT*(310)PPVPARAPRPAAQHEPPARVTSGEALTEPNPPEEQPNASAPQQDRNDSQP ITRVLEHIPGAYGDSAPPAE
Sequence Around Glycosites (21 AA) AVAPAVPPPPTVTPPVPARAP
APAVPPPPTVTPPVPARAPRP
Average Amino Acid Composition around Glycosite(s)_AVAPAVPPPPT(he)VT(he)PPVPAR__AVAPAVPPPPT(he)VT(he)PPVPAR_
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionLC-MS (CID)
Technique(s) used for Glycosylated Residue(s) Detection CID
Glycan Information
Glycan Annotation Hex
Literature
Year of Identification2014
Year of Identification Month Wise2014.1.31
ReferenceSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess. "O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins." Journal of proteomics 97 (2014): 296-306.
AuthorSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA
Corresponding Author Sonja Hess.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA