ProGP459 (ABC-type amino acid transport system secreted component)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP459 (ABC-type amino acid transport system secreted component)
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium smegmatis mc2-155
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 246196
Genome Information
GenBank CP000480.1
EMBL CP000480.1
Gene Information
Gene NameMsmeg_3235
NCBI Gene ID 4537236
GenBank Gene Sequence NC_008596.1
Protein Information
Protein NameABC-type amino acid transport system secreted component
UniProtKB/SwissProt ID A0QXB0
NCBI RefSeq YP_887548.1
EMBL-CDSAFP39617.1
UniProtKB Sequence >tr|A0QXB0|A0QXB0_MYCS2 ABC-type amino acid transport system, secreted component OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_3235 PE=3 SV=1 MWRFAVVLAASGALTLSACASGEGGGESSPESTQAASGAKVDEIANTLPEDIKSSGKLIV GVNIPYAPNEFKDPSGKIVGFDVDLMNAVAATLGLTPEYREADFAKIIPSIQGGTFNVGM SSFTDTKEREQSVDFVTYFSAGSLWAQRVGGGIDPENACGKKVAVQATTVQETDELPARS KKCTDAGQPAIEIVPFDGQDAATNAVVLGQVDAMSADSPVTLYAIKQSNGKLEKAGEVFD SAPYGWPVAKGSPLAQSLQQALQHLIDNGEYEKIAANWGLEDGTIDKPAINGAVS
Sequence length 295 AA
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLC-MS (HCD)
Glycan Information
Glycan Annotation Monosaccharide ( mannose)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT ID
Literature
ReferenceLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M. (2013) Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proc Natl Acad Sci U S A., 110(16):6560-5. [PubMed: 23550160]
AuthorLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M
Research GroupNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France
Corresponding Author Rivière M
ContactNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France