ProGP461

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP461
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv strain ATCC 25618 / H37Rv)
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 83332
Genome Sequence(s)
GenBank NC_000963
EMBL CP009480 
Gene Information
Gene NamelppO (Rv2290)
NCBI Gene ID 887203
GenBank Gene Sequence NC_000962.3
Protein Information
Protein NameLppO (Putative lipoprotein)
UniProtKB/SwissProt ID P9WK71
NCBI RefSeq NP_216806
EMBL-CDSCCP45072.3
UniProtKB Sequence >sp|P9WK71|LPPO_MYCTU Putative lipoprotein LppO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lppO PE=1 SV=1 MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATVMVEGHTHTIS GVVECRTSPAVRTATPSESGTQTTRVNAHDDSASVTLSLSDSTPPDVNGFGISLKIGSVD YQMPYQPVQSPTQVEATRQGKSYTLTGTGHAVIPGQTGMRELPFGVHVTCP
Sequence length 171AA
Subcellular LocationUNKNOWN
Function UNKNOWN
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT73, T75, S77, S79, S81, T83 and S84
Glycosite(s) Annotated Protein Sequence >sp|P9WK71|LPPO_MYCTU Putative lipoprotein LppO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lppO PE=1 SV=1 MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATVMVEGHTHTIS GVVECRTSPAVRT*(73)AT*(75)PS*(77)ES*(79)GT*(81)QT*(83)T*(84)RVNAHDDSASVTLSLSDSTPPDVNGFGISLKIGSVD YQMPYQPVQSPTQVEATRQGKSYTLTGTGHAVIPGQTGMRELPFGVHVTCP
Sequence Around Glycosites (21 AA) CRTSPAVRTATPSESGTQTTR TSPAVRTATPSESGTQTTRVN
PAVRTATPSESGTQTTRVNAH
VRTATPSESGTQTTRVNAHDD
TATPSESGTQTTRVNAHDDSA
ATPSESGTQTTRVNAHDDSAS
Average Amino Acid Composition around Glycosite(s)_T(he)ATPSESGTQTTR__TAT(he)PSESGTQTTR__TATPS(he)ESGTQTTR_TATPS(he)ESGTQTTR__TATPS(he)ESGTQTTR_TATPS(he)ESGTQTTR__TAT(he)PSESGTQT(he)TR_
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionHCD, ETD, CID, LC-MS
Technique(s) used for Glycosylated Residue(s) Detection HCD, ETD, CID
Glycan Information
Glycan Annotation 1 or 2 Hex between 73, 75, 77, 79, 81, 83, 84.
Literature
Year of Identification2014
Year of Identification Month Wise2014.1.31
ReferenceSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess. "O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins." Journal of proteomics 97 (2014): 296-306.
AuthorSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA
Corresponding Author Sonja Hess.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA