ProGP465

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP465
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium smegmatis mc2-155
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 246196
Genome Sequence(s)
GenBank CP000480.1
EMBL CP000480.1
Gene Information
Gene NameMsmeg_3674
NCBI Gene ID 4537448
GenBank Gene Sequence NC_008596.1
Protein Information
Protein NamePutative uncharacterized protein
UniProtKB/SwissProt ID A0QYI9
NCBI RefSeq YP_887977.1
EMBL-CDSABK75035.1
UniProtKB Sequence >tr|A0QYI9|A0QYI9_MYCS2 Uncharacterized protein OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_3674 PE=4 SV=1 MKKLVVLGGGLVVAGSVALLGAGIATSQPTSASINVVGEPYMKALQILKSQGLKATFGGS RGSALPQAECLVDSQKINSSGKVILMLDCTEAAAQQAQDTAVSGGPRVGSNGVTTVTPTP VVPIAGAPGAGTPPPA
Sequence length 136 AA
Function Uncharacterized protein
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionLC-MS (HCD)
Glycan Information
Glycan Annotation Monosaccharide ( mannose)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT62,ProGT63
Characterized Accessory Gene(s)Msmeg_5447
Literature
Year of Identification2013
Year of Identification Month Wise2014.3.5
ReferenceLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M. (2013) Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proc Natl Acad Sci U S A., 110(16):6560-5.
AuthorLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M
Research GroupCentre National de la Recherche Scientifique, Institut de Pharmacologie et de Biologie Structurale, F-31077 Toulouse, France
Corresponding Author Rivière M
ContactCentre National de la Recherche Scientifique, Institut de Pharmacologie et de Biologie Structurale, F-31077 Toulouse, France