ProGP467 (Alanine and proline-rich secreted protei

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP467 (Alanine and proline-rich secreted protei
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium smegmatis mc2-155
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 246196
Genome Information
GenBank CP000480.1
EMBL CP000480.1
Gene Information
Gene NameMsmeg_3618
NCBI Gene ID 4537593
GenBank Gene Sequence NC_008596.1
Protein Information
Protein NameAlanine and proline-rich secreted protein apa
UniProtKB/SwissProt ID A0QYD3
NCBI RefSeq YP_887921.1
EMBL-CDSABK71902.1
UniProtKB Sequence >tr|A0QYD3|A0QYD3_MYCS2 Alanine and proline-rich secreted protein apa OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_3618 PE=4 SV=1 MYESDSMSHRRSGLSKKLTLAAVTGMTAVAVALPSVAHADPEPPPPPPGNTFLPAPPPAD PNAPAPAPAPAPAPAPAPAPALAPAPAPGAPAPAPAPAPAPADPNAPAPAPADPNAPAPA PAEEPPAPEPGRVDNAAGGFSYVVPEGWQVSDATQLSYGQALLTKTVAEGAEPPNDTSVL LGRLDLKLFAGAEPDNNKAAVRLASDMGEFFMPFPGTRVNQQTVQLNADGMPGVASYYEV KFTDANKPAGQIWAGVVGQPVAPGTPRGQRTPERWFVVWLGTANNPIDKDAAVALANSIR PWAPPPPPPPAPADPADPNAAPPPPDPNAPPARPGVGVPVPVTDAPPEMMPPA
Sequence length 353 AA
Subcellular LocationExtracellular region
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLC-MS (HCD)
Glycan Information
Glycan Annotation Monosaccharide ( mannose)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT ID
Literature