ProGP469

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP469
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium smegmatis mc2-155
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 246196
Genome Sequence(s)
GenBank CP000480.1
EMBL CP000480.1
Gene Information
Gene NameMsmeg_828
NCBI Gene ID 4537086
GenBank Gene Sequence NC_008596.1
Protein Information
Protein NameImmunogenic protein MPT63
UniProtKB/SwissProt ID A0QQP4
NCBI RefSeq YP_885232.1
EMBL-CDS ABK74260.1
UniProtKB Sequence >tr|A0QQP4|A0QQP4_MYCS2 Immunogenic protein MPT63 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_0828 PE=4 SV=1 MKISQLTIAAAAALAISGAAGTAGMATAFAEAAQAAQVSANPLGSQARLENGDVVQAWTI SDLKPSSDPIPYAVQGTLWEATATDEAVSGSVIPIVSNLNARAANGENYRVLFQVATPQG VNPSTLAPGQKTTGKVYFDVTGEAPTTVVYNDGERDLLAWSQTAASTTSPRPAATGSGTS ASTPARTAPVTTAPASNTPATELVPESPAVAPTGAAPAAAPGAGAAATDIPGSTVPPLAE DAADEALAEELTEDLPDELSQDSVTPGESVGTPLPAAVQQAPAAPAPGQPAPAAPGAQDI PAAPAGEVPAAPVTPAPAAPVDGSTTPTVPAGSDAPLTAGGIPTLVPAANPGAPTP
Sequence length 356 AA
Subcellular LocationExtracellular space
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLC-MS (HCD)
Glycan Information
Glycan Annotation Monosaccharide ( mannose)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT62,ProGT63
Characterized Accessory Gene(s)Msmeg_5447
Literature
Year of Identification2013
Year of Identification Month Wise2014.3.5
ReferenceLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M. (2013) Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proc Natl Acad Sci U S A., 110(16):6560-5.
AuthorLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M
Research GroupNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France
Corresponding Author Rivière M
ContactNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France