ProGP470

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP470
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium smegmatis mc2-155
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 246196
Genome Sequence(s)
GenBank CP000480.1
EMBL CP000480.1
Gene Information
Gene NameMsmeg_2645
NCBI Gene ID 4533539
GenBank Gene Sequence NC_008596.1
Protein Information
Protein NamePutative protein
UniProtKB/SwissProt ID A0QVP4
NCBI RefSeq YP_886982.1
EMBL-CDSABK71158.1
UniProtKB Sequence >tr|A0QVP4|A0QVP4_MYCS2 Uncharacterized protein OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2645 PE=4 SV=1 MAARVRLLSALCALVAAVILVWQTDPVAGTGSAAPRLDATDLPMTNVSTTIKWPVIETTD PKPFDPCNDIPIDVIERIGLAWTPPMPEDGLRCHYDAGNYQMAVEAFVWRTYEQTIPADA LELDIDGHRAAQYWVMKPTDWNDRWWTTCMIAFDTSYGVIQQSLFYSPIHSPDKPDCLQT NLQRAHELAPYYKF
Sequence length 194 AA
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLC-MS (HCD)
Glycan Information
Glycan Annotation Monosaccharide ( mannose)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT62,ProGT63
Characterized Accessory Gene(s)Msmeg_5447
Literature
Year of Identification2013
Year of Identification Month Wise2014.3.5
ReferenceLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M. (2013) Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proc Natl Acad Sci U S A., 110(16):6560-5.
AuthorLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M
Research GroupNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France
Corresponding Author Rivière M
ContactNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France