ProGP474 (Putative phospholipid-binding lipoprotei

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP474 (Putative phospholipid-binding lipoprotei
Validation Status Uncharacterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Information
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Burkholderia cenocepacia causes opportunistic infections in plants, insects, animals and humans. It acts as a health threat to cystic fibrosis patients, causing lethal necrotizing pneumonia in some cases.
Gene Information
Gene Namebcal0163
Protein Information
Protein NamePutative phospholipid-binding lipoprotein
UniProtKB/SwissProt ID B4EE88
EMBL-CDSCAR50471.1
UniProtKB Sequence >tr|B4EE88|B4EE88_BURCJ Putative phospholipid-binding lipoprotein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAL0163 PE=4 SV=1 MNEGEPSMNQSRVKQTLVRTTLLAALTAGLAVSLQGCVLGVVGAAAGGGALIATDRRTLG AQTEDREIQVKSLTQINNGLPDQSHVNVTVFNRRVLLTGEVPNDASKQRAEEIVRGINNV NGIVNELSVEPASSLSSRANDSYLEGRVKSELIATKGISANYYKVVSERGNLYLMGLVTV DEGNRGAEAASQVPGVEKVVKVFQYVKPQDAQALQDASPASGASGAQAAAAPADNATVGA VPDASVQSTPLQPPAPISNSSSVHPGNPKAKAQ
Sequence length 273 AA
Subcellular LocationInner membrane
Function BON domain: found in osmotic shock protection proteins, in some secretion proteins or haemolysins, likely to attach to phospholipid membranes.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis
Technique(s) used for Glycosylated Residue(s) Detection
Glycan Information
Glycan Annotation Trisaccharide HexNAc-HexNAc-Hex.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLBC
OST ProGT IDProGT71 (PglLBc)
Literature