
Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP474
Validation Status Characterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Sequence(s)
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Causes opportunistic infections in plants, insects, animals, and humans
Gene Information
Gene Namebcal2973
GenBank Gene Sequence NC_011000.1. 
Protein Information
Protein NamePutative uncharacterized protein
UniProtKB/SwissProt ID B4EB72
NCBI RefSeq WP_006486887.1.
Sequence length 117 AA
Subcellular LocationOuter membrane
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS106
Glycosite(s) Annotated Protein Sequence >tr|B4EB72|B4EB72_BURCJ Putative exported protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAL2973 PE=4 SV=1 MKSLVQAVVVAAALVAPVVSFAQSGSTITRAQVRAELVQLQQAGYNSARGEDPHYPEAIQ AATARIAEQQRSALAQAQGADVSGYGAQAQGASASGSRAMGVRPASAEEMKS*(106)LYRGS
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis
Technique(s) used for Glycosylated Residue(s) Detection MS/MS analysis
Glycan Information
Glycan Annotation Trisaccharide HexNAc-HexNAc-Hex.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLBC
Year of Identification2014
Year of Identification Month Wise2014.3.5
ReferenceLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ. (2014) A general protein O-glycosylation system within the Burkholderia cepacia complex is involved in motility and virulence. Mol Microbiol., 92(1):116-37.
AuthorLithgow KV1, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ.
Research GroupDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,
Corresponding Author Dennis JJ.
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,