ProGP475

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP475
Validation Status Characterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Sequence(s)
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Causes opportunistic infections in plants, insects, animals, and humans
Gene Information
Gene Namebcam2680
GenBank Gene Sequence NC_011000.1. 
Protein Information
Protein NamePutative uncharacterized protein
UniProtKB/SwissProt ID B4EKU9
NCBI RefSeq WP_012493607.1
EMBL-CDSCAR56544.1.
UniProtKB Sequence >tr|B4EKU9|B4EKU9_BURCJ Putative membrane protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAM2680 PE=4 SV=1 MASADKETVPSTLHALGGVARSRRTRRIGIGVLIFVVLFGLLGFFAAPPLIRHVAEQQLS KQLDRPATIQRIALNPYTLNLEADGIHLGERGGQGDFIDIGKLVVRPSWSSLFRGAPIVN EVRLDSPRFHIVRYDAQRFNFTDLIEKFSSPTPKPDSKPTQFSVSNIQVNDGRIDFDDRL LNEKHVVDNWTLGIPYIATLASKTDIFVEPKLRARFDGSPISIDGKTKPFAQSRESEIAL KFDRLDVPKLISYVPAKLPVAVTSGLLSSNLTVNFVMSGETPALRVSGTVDLNDAKVTDR ASAPLFAARGVHVAAAGLEPLRNAMHFDEIRLDQPVIDLSRDKQGVLNVEKLVAQPAAAP KVEAGAGKPAASAVAAASGASGAVAAASGAKAERSAAAKEAPPLDLTIRHVAIDGGTINV DDRVPATPTAMSLTKLAATLDGFSLQGKTPAKYTLSTSLSRGGDVTAEGAFNLAAKQADT KLTVAALALPALQPYLGEATRARVLDGTLGATVNAKTDWGKTPLAAEVADSTVSLKSLKI AAPDNKAPAIVLPDASAKIAKVDVAARTAEIASVDASGLALDVKRLKDGKIDLAALAEPA QAAVPKRTVARKAQAAAPSWHYRIDALNVKEASANFTDLSTPRPVKLAIKPLELSVQKVS DDLTKPLPVQLKATLNRKGSLNVTGDVTAQPLKLGLKINGNRLDAAAFEPYFGSALNATI ASALLNAQGNLTFAQVKDTPRATYRGDVALVDVRMLDKATSDPFAGWRSLALSNLKANYD EKGTDVDAARVTFSNFYGRVLLDAQGRLNLKDVVAKETGPAQSLTRDASKGEPVPLSPGV TPPAAAQAASAAAAQQASVPAAASATVVVKAAPQPQNPVRMHFGELVLQNGRVTYTDNFI KPNYTANLVAIKGTVGAFGTDSTTSAPVDVAANLAGNGPISIKGSVNPLIEKPALDLTAT AHDIELTNLTPYSAKYAGYPITKGKLNVDLHYQLANDQLSANNHIFIDQLTFGDHVENDT ATKLPVKLAISLLKNTRGQIDVNLPVSGSLSNPEFSVGGLIWHAVLNLIAKAVTSPFTLL ANAFGGGGGEDLGYVEFAPGSYALTDTQQKKLDTVVKMLTEKPSIRLDLIGRVDPAQDTP GLRDAYVERLVRQQKLKDVVGQGESVDPMSVKVDKAEYSKYLTRAYKAADFKKPRNLVGL QKTLPDADMKQALADHAPADDNALRALAQQRAQAVRQYLDGKIDSSRMFVVAPKLDAKGI SDKGATTRVDFGLQ
Sequence length 1274 AA
Subcellular LocationInner membrane
Function DUF748, homology to type I phosphodiesterase/nucleotide pyrophosphatase.
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS396
Glycosite(s) Annotated Protein Sequence >tr|B4EKU9|B4EKU9_BURCJ Putative membrane protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAM2680 PE=4 SV=1 MASADKETVPSTLHALGGVARSRRTRRIGIGVLIFVVLFGLLGFFAAPPLIRHVAEQQLS KQLDRPATIQRIALNPYTLNLEADGIHLGERGGQGDFIDIGKLVVRPSWSSLFRGAPIVN EVRLDSPRFHIVRYDAQRFNFTDLIEKFSSPTPKPDSKPTQFSVSNIQVNDGRIDFDDRL LNEKHVVDNWTLGIPYIATLASKTDIFVEPKLRARFDGSPISIDGKTKPFAQSRESEIAL KFDRLDVPKLISYVPAKLPVAVTSGLLSSNLTVNFVMSGETPALRVSGTVDLNDAKVTDR ASAPLFAARGVHVAAAGLEPLRNAMHFDEIRLDQPVIDLSRDKQGVLNVEKLVAQPAAAP KVEAGAGKPAASAVAAASGASGAVAAASGAKAERS*(396)AAAKEAPPLDLTIRHVAIDGGTINV DDRVPATPTAMSLTKLAATLDGFSLQGKTPAKYTLSTSLSRGGDVTAEGAFNLAAKQADT KLTVAALALPALQPYLGEATRARVLDGTLGATVNAKTDWGKTPLAAEVADSTVSLKSLKI AAPDNKAPAIVLPDASAKIAKVDVAARTAEIASVDASGLALDVKRLKDGKIDLAALAEPA QAAVPKRTVARKAQAAAPSWHYRIDALNVKEASANFTDLSTPRPVKLAIKPLELSVQKVS DDLTKPLPVQLKATLNRKGSLNVTGDVTAQPLKLGLKINGNRLDAAAFEPYFGSALNATI ASALLNAQGNLTFAQVKDTPRATYRGDVALVDVRMLDKATSDPFAGWRSLALSNLKANYD EKGTDVDAARVTFSNFYGRVLLDAQGRLNLKDVVAKETGPAQSLTRDASKGEPVPLSPGV TPPAAAQAASAAAAQQASVPAAASATVVVKAAPQPQNPVRMHFGELVLQNGRVTYTDNFI KPNYTANLVAIKGTVGAFGTDSTTSAPVDVAANLAGNGPISIKGSVNPLIEKPALDLTAT AHDIELTNLTPYSAKYAGYPITKGKLNVDLHYQLANDQLSANNHIFIDQLTFGDHVENDT ATKLPVKLAISLLKNTRGQIDVNLPVSGSLSNPEFSVGGLIWHAVLNLIAKAVTSPFTLL ANAFGGGGGEDLGYVEFAPGSYALTDTQQKKLDTVVKMLTEKPSIRLDLIGRVDPAQDTP GLRDAYVERLVRQQKLKDVVGQGESVDPMSVKVDKAEYSKYLTRAYKAADFKKPRNLVGL QKTLPDADMKQALADHAPADDNALRALAQQRAQAVRQYLDGKIDSSRMFVVAPKLDAKGI SDKGATTRVDFGLQ
Sequence Around Glycosites (21 AA) AAASGAKAERSAAAKEAPPLD
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis
Technique(s) used for Glycosylated Residue(s) Detection MS/MS analysis
Glycan Information
Glycan Annotation Trisaccharide HexNAc-HexNAc-Hex.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLBC
OST ProGT IDProGT72
Literature
Year of Identification2014
Year of Identification Month Wise2014.3.5
ReferenceLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ. (2014) A general protein O-glycosylation system within the Burkholderia cepacia complex is involved in motility and virulence. Mol Microbiol., 92(1):116-37.
AuthorLithgow KV1, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ.
Research GroupDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,
Corresponding Author Dennis JJ.
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,