ProGP485 (oprM efflux system outer membrane protei

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP485 (oprM efflux system outer membrane protei
Validation Status Uncharacterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Information
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Burkholderia cenocepacia causes opportunistic infections in plants, insects, animals and humans. It acts as a health threat to cystic fibrosis patients, causing lethal necrotizing pneumonia in some cases.
Gene Information
Gene Namebcal2820
Protein Information
Protein NameoprM efflux system outer membrane protein
UniProtKB/SwissProt ID B4EA04
NCBI RefSeq WP_012492848.1
EMBL-CDSCAR53120.1
UniProtKB Sequence >tr|B4EA04|B4EA04_BURCJ Efflux system outer membrane protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=oprM PE=3 SV=1 MMQKHALTAIAVALFATGCTMAPHYKRPDAPVAQAYPASGVYATQPGAAGARSANGQAAT AIGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNR QRLPNSLTAVPGRNITTTYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQASEISL VSQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETAL ANQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDAQNLLTDVPAGLPSDLLTRRPDVM QAEQTLLAANANIGAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFE GGQNIANLDLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRR FDLSDLRYKNGVDSYLSVLTAQTDLYAAQQSLISARLARWTNLVDLYRALGGGWIQRAGE TPRAPDAPVDYDKAAAPAPASATATNG
Sequence length 507 AA
Subcellular LocationOuter membrane
Function Predicted NodT-like lipoprotein involved in efflux.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis
Glycan Information
Glycan Annotation Trisaccharide HexNAc-HexNAc-Hex.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLBC
OST ProGT IDProGT71 (PglLBc)
Literature