ProGP509 (Ccop)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP509 (Ccop)
Validation Status Uncharacterized
Organism Information
Organism NameNeisseria meningitidis C311 and MC58
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 491
Genome Information
GenBank AE002098.2
EMBL AE002098
Organism Additional Information Neisseria meningitidis (Gram-negative bacterium) is the causative agent of cerebrospinal meningitis. Sometimes, it crosses the epithelium using its pili to enter the bloodstream. After rapid proliferation, this leads to septicemia. It also crosses the blood-brain barrier to proliferate in the brain.
Gene Information
Gene Nameccop (NMB_1723) or fixP
Protein Information
Protein NameCcop
UniProtKB/SwissProt ID Q9JY60
NCBI RefSeq NP_274726.1
EMBL-CDSAAF42068.2
UniProtKB Sequence >tr|Q9JY60|Q9JY60_NEIMB Cytochrome c oxidase, subunit III OS=Neisseria meningitidis serogroup B (strain MC58) GN=fixP PE=4 SV=1 MNTTSQFTSNFWNIYIAVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTGHEWDGIAEYD NPLPRWWFWLCVLTWLFGIGYLVMYPGVGDYKGLLKWTSHNQYEKEVKKADEQYGKLYAK FADMPIEKVAKDPQAKQIAQNLFNTYCIQCHGSDAKGSKGFPNLTDSDWLWGGDPDKIHE TIEKGRVATMPAWGPALGEEGVKDVAHYVMSLSKPEGQYDEERAARGQALFSGPPANCFT CHGDKGQGIQGLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY VWGLSDKDGKAPVKKAEPAPTPAPAAEPAASAPAEAAQAVSEAKPAAAEPKAEEKAAPAA KADGK
Sequence length 365 AA
Subcellular LocationMembrane
Function Cytochrome c oxidase, subunit III
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionMass Spectrometry
Literature
Year of Identification2015
Year of Identification Month Wise2015.5.1
ReferenceSchulz BL, Jen FE, Power PM, Jones CE, Fox KL, Ku SC, Blanchfield JT, Jennings MP. (2013)Identification of bacterial protein O-oligosaccharyltransferases and their glycoprotein substrates. PLoS One, 8(5): e62768. [PubMed: 23658772]
AuthorBenjamin L. Schulz, Freda E. C. Jen, Peter M. Power, Christopher E. Jones, Kate L. Fox, Shan C. Ku, Joanne T. Blanchfield, and Michael P. Jennings
Research GroupSchool of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, Queensland, Australia.
Corresponding Author Michael P. Jennings
ContactSchool of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, Queensland, Australia.