ProGP51 (Alanine and proline-rich secreted protein

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP51 (Alanine and proline-rich secreted protein
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Information
GenBank BX842578.1
EMBL BX842578
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameApa (Rv1860) or modD
NCBI Gene ID 885896
GenBank Gene Sequence NC_000962
Protein Information
Protein NameAlanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32)
UniProtKB/SwissProt ID P9WIR7
NCBI RefSeq YP_177849.1
EMBL-CDSCAE55438.1
UniProtKB Sequence >sp|P9WIR6|APA_MYCTO Alanine and proline-rich secreted protein Apa OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=apa PE=3 SV=1 MHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPTTAASPPSTAAA PPAPATPVAPPPPAAANTPNAQPGDPNAAPPPADPNAPPPPVIAPNAPQPVRIDNPVGGF SFALPAGWVESDAAHLDYGSALLSKTTGDPPFPGQPPPVANDTRIVLGRLDQKLYASAEA TDSKAAARLGSDMGEFYMPYPGTRINQETVSLDANGVSGSASYYEVKFSDPSKPNGQIWT GVIGSPAANAPDAGPPQRWFVVWLGTANNPVDKGAAKALAESIRPLVAPPPAPAPAPAEP APAPAPAGEVAPTPTTPTPQRTLPA
Sequence length 325 AA
Subcellular LocationSecreted
Function Immunodominant antigen. Elicits potent DTH (delayed-type hypersensitivity) responses in living-BCG-immunized guinea pigs..Stimulation of peripheral blood mononuclear cells from PPD positive individuals with Apa induces a Th1 type lymphoproliferative response with expansion of both CD4+ and CD8+ cells and increased IFN-? production. 2) In Mtb, mannosylated nApa is a potential adhesin and has a role in host cell attachment, entry, and immune evasion, it induces a strong delayed-type hypersensitivity (DTH) in immunized animals, Elicits a mostly Th1 type of T-cell response in healthy humans; induces IFN-gamma production from CD4+ and CD8+ cells, Functions as an adhesin, binds to mouse macrophages via mannose residues
Glycosylation Status
Glycosylation Type O- (Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-39) T49, T57, T66, T316, T313,T315
Experimentally Validated Glycosite(s ) in Mature ProteinT10, T18, T27, T277
Glycosite(s) Annotated Protein Sequence >sp|Q50906|APA_MYCTU Alanine and proline-rich secreted protein apa OS=Mycobacterium tuberculosis GN=apa PE=1 SV=1 MHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPT*(49)TAASPPST*(57)AAA PPAPAT*(66)PVAPPPPAAANTPNAQPGDPNAAPPPADPNAPPPPVIAPNAPQPVRIDNPVGGF SFALPAGWVESDAAHFDYGSALLSKTTGDPPFPGQPPPVANDTRIVLGRLDQKLYASAEA TDSKAAARLGSDMGEFYMPYPGTRINQETVSLDANGVSGSASYYEVKFSDPSKPNGQIWT GVIGSPAANAPDAGPPQRWFVVWLGTANNPVDKGAAKALAESIRPLVAPPPAPAPAPAEP APAPAPAGEVAPTPTT*(316)PTPQRTLPA
Sequence Around Glycosites (21 AA) ADPEPAPPVPTTAASPPSTAA
VPTTAASPPSTAAAPPAPATP
STAAAPPAPATPVAPPPPAAA
PAGEVAPTPTTPTPQRTLPA
ProGP Web Logo
Technique(s) used for Glycosylation DetectionSchiff's staining, peroxidase-conjugated concanavalin A (ConA)-binding
Technique(s) used for Glycosylated Residue(s) Detection N-terminal amino acid sequencing coupled with fast atom bombardment-mass spectrometry (FAB-MS), Edman degradation on a gas-phase sequencer , FAB-MS
Protein Glycosylation- Implication The presence of the mannose residues on the Apa protein was essential for the antigenicity of the molecules in T-cell-dependent immune responses in vitro (proliferation assay) and in vivo (delayed type hypersensitivity or DTH reaction). The deglycosylated antigen was 10-fold less active than native molecules in eliciting DTH. Mannosylation of antigen leads to selective targeting and subsequent greater presentation by dendritic cells. 2) In Mtb,mannosylated nApa is a potential adhesin and has a role in host cell attachment, entry, and immune evasion
Glycan Information
Glycan Annotation Linkage: αMan-Thr.
34.6% sugar detected.
α-D-Manp(1→2)α-D-Manp (mannobiose), α-D-Manp (single mannose), α-D-Manp(1→2)α-D-Manp(1→2)α-D-Manp (mannotriose) are present. T10 and T18 are glycosylated with mannobiose, T27 with single mannose, and T277 with either of the three. The majority of the antigen species bear six, seven, or eight mannose residues (22, 24, and 17%, respectively), while others three, four, or five mannoses (5, 9, and 14%, respectively). Alpha-D-Man, mannobiose, or mannotriose, Thr residues at positions 10 and 18 were substituted a-D-Manp(132)a-D-Manp, position 27 was substituted with a single a-D-Manp, Thr-277 was substituted with either a-D-Manp, a-D-Manp(132)a-D-Manp, or a-D-Manp(132)a-D-Manp (132)a-D-Manp.
Technique(s) used for Glycan Identification GC-MS of partially methylated alditol acetates obtained by trifluoro acetic acid (TFA) hydrolysis of permethylated oligoglycosyl alditols which are released by ?-elimination of the glycopeptides.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameProtein O-mannosyltransferase
OST ProGT IDProGT12 (Rv1002c)
Literature