ProGP512

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP512
Validation Status Uncharacterized
Organism Information
Organism NameNeisseria meningitidis C311 and MC58
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 491
Genome Sequence(s)
GenBank AE002098.2
EMBL AE002098
Gene Information
Gene Nameccop (NMB_1723) or fixP
Protein Information
Protein NameCcop
UniProtKB/SwissProt ID Q9JY60
NCBI RefSeq NP_274726.1
EMBL-CDSAAF42068.2
UniProtKB Sequence >tr|Q9JY60|Q9JY60_NEIMB Cytochrome c oxidase, subunit III OS=Neisseria meningitidis serogroup B (strain MC58) GN=fixP PE=4 SV=1 MNTTSQFTSNFWNIYIAVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTGHEWDGIAEYD NPLPRWWFWLCVLTWLFGIGYLVMYPGVGDYKGLLKWTSHNQYEKEVKKADEQYGKLYAK FADMPIEKVAKDPQAKQIAQNLFNTYCIQCHGSDAKGSKGFPNLTDSDWLWGGDPDKIHE TIEKGRVATMPAWGPALGEEGVKDVAHYVMSLSKPEGQYDEERAARGQALFSGPPANCFT CHGDKGQGIQGLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY VWGLSDKDGKAPVKKAEPAPTPAPAAEPAASAPAEAAQAVSEAKPAAAEPKAEEKAAPAA KADGK
Sequence length 365 AA
Subcellular LocationMembrane
Function Cytochrome c oxidase, subunit III
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionMass Spectrometry
Literature
Year of Identification2015
Year of Identification Month Wise2015.5.1
ReferenceBenjamin L. Schulz, Freda E. C. Jen, Peter M. Power, Christopher E. Jones, Kate L. Fox, Shan C. Ku, Joanne T. Blanchfield, and Michael P. Jennings (2013) Identification of Bacterial Protein O-Oligosaccharyltransferases and Their Glycoprotein Substrates. PLoS One. 2013; 8(5): e62768.
AuthorBenjamin L. Schulz, Freda E. C. Jen, Peter M. Power, Christopher E. Jones, Kate L. Fox, Shan C. Ku, Joanne T. Blanchfield, and Michael P. Jennings
Research GroupSchool of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, Queensland, Australia.
Corresponding Author Michael P. Jennings
ContactSchool of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, Queensland, Australia.