ProGP513

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP513
Validation Status Uncharacterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Sequence(s)
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Causes opportunistic infections in plants, insects, animals, and humans
Gene Information
Gene NameFliC (BCAL0114)
NCBI Gene ID KC763156
GenBank Gene Sequence KC763156.1
Protein Information
Protein NameFliC (Flagellin)
UniProtKB/SwissProt ID M9YNZ2
NCBI RefSeq AGK24641.1
EMBL-CDSAGK24641.1
UniProtKB Sequence >tr|M9YNZ2|M9YNZ2_9BURK Flagellin OS=Burkholderia cenocepacia GN=fliC PE=3 SV=1 MLGINSNINSLVAQQNLNGSQNALSQAITRLSSGKRINSAADDAAGLAISTRMQTQINGL NQGVSNANDGVSMIQTASSALSSLTNSLQRIRQLAVQASTGTMSTTDQAALQQEVSQQIQ EVNRIASQTTYNGTNILDGSAGIVSFQVGANVGQTISLDLSQSMSAAKIGGGLVQKGQTV GTVTGLSLDNNGAYTGSGATITAINVLSDGKGGYTFTDQNGGAISQTVAQSVFGANATTG TGTAVGNLTLQSGATGAGTSAAQQTAITNAIAQINAVNKPATVSNLDISTVSGANVAMVS IDNALQTVNNVQAALGAAQNRFTAIATSQQAESTDLSSAQSQITDANFAQETANMSKNQV LQQAGISVLAQANSLPQQVLKLLQ
Sequence length 384 AA
Subcellular LocationSecreted Flaggellin
Function Motility
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein10 glycosites identified each with 231 Da modification
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDigestion with Trypsin, Chymotrypsin, AspN and mixture of AspN and trypsin and then MS and MSMS
Protein Glycosylation- Implication The O-antigen cluster gene rmlB is required for bacterial viability. Flagellin glycan was shown to impair the inflammatory response of epithelial cells. The glycosylation was suggested to help the infecting bacteria in immune evasion by reducing the flagellin recognition through host TLR5.
Glycan Information
Glycan Annotation 4,6-dideoxy-4-(3-hydroxybutanoylamino)-D-glucose. Protein is glycosylated on at least ten different sites.
Technique(s) used for Glycan Identification GC/MS ( Beta elimination)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameFlmQ
OST ProGT IDProGT72
Literature
Year of Identification2014
Year of Identification Month Wise2014.7.4
ReferenceHanuszkiewicz A, Pittock P, Humphries F, Moll H, Rosales AR, Molinaro A, Moynagh PN, Lajoie GA, Valvano MA. (2014) Identification of the flagellin glycosylation system in Burkholderia cenocepacia and the contribution of glycosylated flagellin to evasion of human innate immune responses. J Biol Chem. 289, 19231-44. [PMID: 24841205 ]
AuthorHanuszkiewicz A1, Pittock P2, Humphries F3, Moll H4, Rosales AR5, Molinaro A6, Moynagh PN7, Lajoie GA2, Valvano MA8.
Research Group1 From the Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queen's University, Belfast BT9 7AE, Ireland, United Kingdom. 2 the Don Rix Protein Identification Facility, Department of Biochemistry, University of Western Ontario, London, Ontario N6A 5C1, Canada. 3 the Institute of Immunology, Department of Biology, National University of Ireland at Maynooth, Maynooth, County Kildare, Ireland. 4 the Bioanalytical Chemistry, Research Centre Borstel, 23845 Borstel, Germany. 5 the Department of Microbiology and Immunology, University of Western Ontario, London, Ontario N6A 5C1, Canada, and. 6 the Dipartimento di Scienze Chimiche, Università di Napoli, Federico II, 80134 Naples, Italy. 7 From the Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queen's University, Belfast BT9 7AE, Ireland, United Kingdom, the Institute of Immunology, Department of Biology, National University of Ireland at Maynooth, Maynooth, County Kildare, Ireland. 8 From the Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queen's University, Belfast BT9 7AE, Ireland, United Kingdom, the Department of Microbiology and Immunology, University of Western Ontario, London, Ontario N6A 5C1, Canada,
Corresponding Author Valvano MA
ContactFrom the Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queen's University, Belfast BT9 7AE, Ireland, United Kingdom, the Department of Microbiology and Immunology, University of Western Ontario, London, Ontario N6A 5C1, Canada,