ProGP514

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP514
Validation Status Characterized
Organism Information
Organism NameEnterococcus faecalis F4-9
Domain Bacteria
Classification Family: Enterococcaceae
Order: Lactobacillales
Class: Bacilli
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1351
Genome Sequence(s)
GenBank  LC029806.1
EMBL  LC029806.1
Gene Information
Gene NameenfA49
GenBank Gene Sequence LC029806.1
Protein Information
Protein NameEnterocin F4-9
UniProtKB/SwissProt ID A0A0G4DCS0
NCBI RefSeq WP_002396198.1
EMBL-CDSBAR87969.1
UniProtKB Sequence >tr|A0A0G4DCS0|A0A0G4DCS0_ENTFL Enterocin F4-9 OS=Enterococcus faecalis GN=enfA49 PE=4 SV=1 MGNSILNKMTVEEMEAVKGGNLVCPPMPDYIKRLSTGKGVSSVYMAWQIANCKSSGSCMKGQTNRTC
Sequence length 67 AA
Subcellular LocationExtracellular
Function Bacteriocin
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS37 and T46
Glycosite(s) Annotated Protein Sequence >tr|A0A0G4DCS0|A0A0G4DCS0_ENTFL Enterocin F4-9 OS=Enterococcus faecalis GN=enfA49 PE=4 SV=1 MGNSILNKMTVEEMEAVKGGNLVCPPMPDYIKRLSTGKGVSSVYMAWQIANCKSSGS*(37)CMKGQTNRT*(46)C
Sequence Around Glycosites (21 AA) WQIANCKSSGSCMKGQTNRTC
Technique(s) used for Glycosylation DetectionMass spectrometry (ESI-TOF MS)
Technique(s) used for Glycosylated Residue(s) Detection Deglycosylation and Edman degradation
Protein Glycosylation- Implication Essential for bioactivity
Glycan Information
Glycan Annotation GlcNAc
Technique(s) used for Glycan Identification Deglycosylation using β-N-acetylglucosaminidase
Literature
Year of Identification2015
Year of Identification Month Wise2015.05.08
Year of Validation 2015
ReferenceMaky MA, Ishibashi N, Zendo T, Perez RH, Doud JR, Karmi M, Sonomoto K. (2015) Enterocin F4-9, a Novel O-Linked Glycosylated Bacteriocin. Appl Environ Microbiol. 81(14), 4819-26. [PMID: 25956765]
AuthorMaky MA, Ishibashi N, Zendo T, Perez RH, Doud JR, Karmi M, Sonomoto K.
Research Group1 Laboratory of Microbial Technology, Division of Systems Bioengineering, Department of Bioscience and Biotechnology, Faculty of Agriculture, Graduate School, Kyushu University, Higashi-ku, Fukuoka, Japan Department of Food Hygiene and Control, Faculty of Veterinary Medicine, South Valley University, Qena, Egypt. 2 Laboratory of Microbial Technology, Division of Systems Bioengineering, Department of Bioscience and Biotechnology, Faculty of Agriculture, Graduate School, Kyushu University, Higashi-ku, Fukuoka, Japan. 3 Department of Food Hygiene and Control, Faculty of Veterinary Medicine, South Valley University, Qena, Egypt. 4 Department of Food Hygiene and Control, Faculty of Veterinary Medicine, Aswan University, Aswan, Egypt. 5 Laboratory of Microbial Technology, Division of Systems Bioengineering, Department of Bioscience and Biotechnology, Faculty of Agriculture, Graduate School, Kyushu University, Higashi-ku, Fukuoka, Japan Department of Functional Metabolic Design, Bio-Architecture Center, Kyushu University, Fukuoka, Japan sonomoto@agr.kyushu-u.ac.jp.