ProGP515

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP515
Validation Status Characterized
Organism Information
Organism NameKingella kingae
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 504
Genome Sequence(s)
GenBank LN869922.1
EMBL LN869922.1
Gene Information
Gene Nameknh
NCBI Gene ID 29366562
GenBank Gene Sequence NZ_LN869922.1
Protein Information
Protein NameKnh
UniProtKB/SwissProt ID A0A0P1D0G7
NCBI RefSeq WP_060536913.1
EMBL-CDSCRZ19414.1.
UniProtKB Sequence >tr|A0A0P1D0G7|A0A0P1D0G7_9NEIS Knh OS=Kingella kingae GN=knh PE=4 SV=1 MNHTYRVVYNESTNTYVAVAEFEPSKGKSKSSKKAVAVAVALAAAQLVPLTAQAAVSIGS TSGTSIRTEAAKGEGEGVAVGSRASVTGIGNAVAVGYGASAEGTDVAVGPNATATGSDNI AIGNHTKASSDKKDSNYGIIAIGNQSNGSASEVVAIGQLACATASQAVALGSQTQATGEQ SVAIGGNTISSGASALAIGGDDLNKASSVGRSTDGKPNTTNTTDADINKGAVNTEFKKIS GQDLVKKIDKQTSTDNTAAQYMPTNAYGAASIAIGIQSRSGDLATAFGTQSFATGLASTA LGVASNASGNGSIAIGPGTDATGEQSIGMGANASSSNNHSIAIGTNATASGNQSISIGYA NNVSGNNSGAFGDLSTITGSGAYTVGNNNTMAANEAGAFGNLNNFTSAANYSRAVGNRNN VSGSNTMVLGNDVNATTNGSVVLGNGSSGSMSVVTCSSATVNGITYGSFTGAVKDTGKYV SVGASADDARKIVNVAAGNITSNSTEAINGSQLYMTQNVIGNLANSTAQALGPNSTVNTN GTISPNITVNGSTATYTTVQDAINNVSFNVNADKSGTGNVSGNNAQLVKPGDEVKFIAGD NLNLTQTGSNFTYSLNKDINLTTEGSLKVGLVTINKDGINAGNATISNVKGNLPNTYNKD TLTPNGDPSNVGNPVTKSQTLPSNLKVNNAATVGDVLNAGWNLQGNGQAVDFVKPYDTVN FVNGVGTTANVTVNENGTVTDVTYNVNADGKTTEITYVDNAGNTVYKQADGSYNTKKDGS GSPVNASNVTSQISAIKGVDNVTLLTNGTTTTVTNKGTAEAPNYVVEVKKVNVTTTPTNT PDANNVTINEAGKVVAPTNSTVAGNTFLTAKDVADVINNSGFTLTSSNEGTSTGQSDVIN PGDKVTINGGKNINITQTGSTITVATKDNVTFNNVNTTTMTVGSKPDNAVNFKAEKATPA NNNSKTNAPTTALNITSADGKPTQITGVASSLNTTTVAINPDSNATTKEQPATLVDLANA SNVNAAATVGDLQNMGWVVSTKDSNGYTDVVKNSNQVDFKGTGLATVKGETVNGVRTITV DVNAQSTVENAQLPIVYTNENGDKLVKGQNGKFYKPADIANATYNPTTKTYTNTAGATVA PATTVIASMNNGDNNTTAPMTLTNVKGTLENTTSVANADGKGNAATGIGAEVTKAKAAPT LKAVRLNNAATVGDVLNAGWNLQGNGQAVDFVRPYDTVNFVNGAGTTATVTSDGNRSNVS YNVAVDNKTTQIVDEKGNPLVKANDGKYYPVNQVDGSNNPITGAAPVTNTQVAAKTTTLD VSTEPMTANNNTPAGKVVTPNTENGSSLVNATTVANAINNSGFTLKAQGENASVVNPGGT VDMKNTDGNIVISKNVANNDVVYDLAKNITVDSVTAGNTTVNNAGITIKNADPNKTVSLT DGGLNNGGNTITNVAAGVNDTDAVNVSQLKSNVSQLKSQVAASKEEVTSNDKTVRVNVST NATTGANIYDVSVNTGKSLTINSTTGAIDVKTDDTTIKQGSTGALEVVTTNLTVANNGKV DTPTNGSSLVNATTVANAINNSGWNLQANGDTASKVSPGNTVQFLNGGNIDIKRDGNNIT VATSKDINVKGDLTVAGNTTVNNFTVNPNSTVNMGGNKVQGVAAGVISANSTDAINGSQL YYTNQAIGANINNVANNLNARINDVADDADAGTASAMATAGVPQAYLPGKSMVAVGASTY RGKQGYAVGFSAISDSGNWIVKGTASGNSRGHFGATVGAGYQW
Sequence length 1783 AA
Subcellular Locationintegral component of membrane
Function Trimeric autotransporter protein
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN218, N221, N603, N610, N640, N643, N665, N670, N785, N788, N801, N807, N844, N845, N849, N859, N865, N912, N914, N929, N967, N974, N1171, N1267, N1329, N1330, N1371, N1376, N1497, N1501, N1522, N1638 and N1649
Glycosite(s) Annotated Protein Sequence >tr|A0A0P1D0G7|A0A0P1D0G7_9NEIS Knh OS=Kingella kingae GN=knh PE=4 SV=1 MNHTYRVVYNESTNTYVAVAEFEPSKGKSKSSKKAVAVAVALAAAQLVPLTAQAAVSIGS TSGTSIRTEAAKGEGEGVAVGSRASVTGIGNAVAVGYGASAEGTDVAVGPNATATGSDNI AIGNHTKASSDKKDSNYGIIAIGN*(218)QSN*(221)GSASEVVAIGQLACATASQAVALGSQTQATGEQ SVAIGGNTISSGASALAIGGDDLNKASSVGRSTDGKPNTTNTTDADINKGAVNTEFKKIS GQDLVKKIDKQTSTDNTAAQYMPTNAYGAASIAIGIQSRSGDLATAFGTQSFATGLASTA LGVASNASGNGSIAIGPGTDATGEQSIGMGANASSSNNHSIAIGTNATASGNQSISIGYA NNVSGNNSGAFGDLSTITGSGAYTVGNNNTMAANEAGAFGNLNNFTSAANYSRAVGNRNN VSGSNTMVLGNDVNATTNGSVVLGNGSSGSMSVVTCSSATVNGITYGSFTGAVKDTGKYV SVGASADDARKIVNVAAGNITSNSTEAINGSQLYMTQNVIGNLANSTAQALGPNSTVNTN GTISPNITVNGSTATYTTVQDAINNVSFNVNADKSGTGNVSGNNAQLVKPGDEVKFIAGD NLN*(603)LTQTGSN*(610)FTYSLNKDINLTTEGSLKVGLVTINKDGIN*(640)AGN*(643)ATISNVKGNLPNTYNKD TLTPN*(665)GDPSN*(670)VGNPVTKSQTLPSNLKVNNAATVGDVLNAGWNLQGNGQAVDFVKPYDTVN FVNGVGTTANVTVNENGTVTDVTYNVNADGKTTEITYVDNAGNTVYKQADGSYNTKKDGS GSPVN*(785)ASN*(788)VTSQISAIKGVDN*(801)VTLLTN*(807)GTTTTVTNKGTAEAPNYVVEVKKVNVTTTPTNT PDAN*(844)N*(845)VTIN*(849)EAGKVVAPTN*(859)STVAGN*(865)TFLTAKDVADVINNSGFTLTSSNEGTSTGQSDVIN PGDKVTINGGKN*(912)IN*(914)ITQTGSTITVATKDN*(929)VTFNNVNTTTMTVGSKPDNAVNFKAEKATPA NNNSKTN*(967)APTTALN*(974)ITSADGKPTQITGVASSLNTTTVAINPDSNATTKEQPATLVDLANA SNVNAAATVGDLQNMGWVVSTKDSNGYTDVVKNSNQVDFKGTGLATVKGETVNGVRTITV DVNAQSTVENAQLPIVYTNENGDKLVKGQNGKFYKPADIANATYNPTTKTYTNTAGATVA PATTVIASMNNGDNNTTAPMTLTNVKGTLEN*(1171)TTSVANADGKGNAATGIGAEVTKAKAAPT LKAVRLNNAATVGDVLNAGWNLQGNGQAVDFVRPYDTVNFVNGAGTTATVTSDGNRSNVS YNVAVDN*(1267)KTTQIVDEKGNPLVKANDGKYYPVNQVDGSNNPITGAAPVTNTQVAAKTTTLD VSTEPMTAN*(1329)N*(1330)NTPAGKVVTPNTENGSSLVNATTVANAINNSGFTLKAQGENASVVNPGGT VDMKNTDGN*(1371)IVISKN*(1376)VANNDVVYDLAKNITVDSVTAGNTTVNNAGITIKNADPNKTVSLT DGGLNNGGNTITNVAAGVNDTDAVNVSQLKSNVSQLKSQVAASKEEVTSNDKTVRVN*(1497)VST N*(1501)ATTGANIYDVSVNTGKSLTIN*(1522)STTGAIDVKTDDTTIKQGSTGALEVVTTNLTVANNGKV DTPTNGSSLVNATTVANAINNSGWNLQANGDTASKVSPGNTVQFLNGGNIDIKRDGNN*(1638)IT VATSKDIN*(1649)VKGDLTVAGNTTVNNFTVNPNSTVNMGGNKVQGVAAGVISANSTDAINGSQL YYTNQAIGANINNVANNLNARINDVADDADAGTASAMATAGVPQAYLPGKSMVAVGASTY RGKQGYAVGFSAISDSGNWIVKGTASGNSRGHFGATVGAGYQW
Sequence Around Glycosites (21 AA) SVGRSTDGKPNTTNTTDADIN
RSTDGKPNTTNTTDADINKGA
EVKFIAGDNLNLTQTGSNFTY DNLNLTQTGSNFTYSLNKDIN
GLVTINKDGINAGNATISNVK TINKDGINAGNATISNVKGNL
NTYNKDTLTPNGDPSNVGNPV DTLTPNGDPSNVGNPVTKSQT
NTYNKDTLTPNGDPSNVGNPV DTLTPNGDPSNVGNPVTKSQT
SQISAIKGVDNVTLLTNGTTT KGVDNVTLLTNGTTTTVTNKG
TTTPTNTPDANNVTINEAGKV
TTPTNTPDANNVTINEAGKVV
NTPDANNVTINEAGKVVAPTN
NEAGKVVAPTNSTVAGNTFLT
VAPTNSTVAGNTFLTAKDVAD
GDKVTINGGKNINITQTGSTI KVTINGGKNINITQTGSTITV
GSTITVATKDNVTFNNVNTTT
ATPANNNSKTNAPTTALNITS SKTNAPTTALNITSADGKPTQ
TLTNVKGTLENTTSVANADGK
SNVSYNVAVDNKTTQIVDEKG
LDVSTEPMTANNNTPAGKVVT
DVSTEPMTANNNTPAGKVVTP
SGFTLKAQGENASVVNPGGTV
KAQGENASVVNPGGTVDMKNT
VTSNDKTVRVNVSTNATTGAN DKTVRVNVSTNATTGANIYDV
SVNTGKSLTINSTTGAIDVKT
NVKGDLTVAGNTTVNNFTVNP
TTVNNFTVNPNSTVNMGGNKV
Glycosite Sequence Logo
Technique(s) used for Glycosylated Residue(s) Detection Mass spectrometry analysis
Glycan Information
Glycan Annotation All 32 sites were modified with at least a single hexose, and N1267, N1371, N1638 and N1649 were modified with either a single hexose or a dihexose.
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT88
Characterized Accessory Gene(s)hmw1CKk
Literature
Year of Identification2015
Year of Identification Month Wise2015.8.25
Year of Validation 2015
ReferenceKatherine A. Rempe, Lynn A. Spruce, Eric A. Porsch, Steven H. Seeholzer, Niels Nørskov-Lauritsen,Joseph W. St. Geme III ( 2015). Unconventional N-Linked Glycosylation Promotes Trimeric Autotransporter Function in Kingella kingae and Aggregatibacter aph
AuthorKatherine A. Rempe, Lynn A. Spruce, Eric A. Porsch, Steven H. Seeholzer, Niels Nørskov-Lauritsen,Joseph W. St. Geme III
Research GroupThe Children's Hospital of Philadelphia, Philadelphia, Pennsylvania, USA University of Pennsylvania Perelman School of Medicine, Philadelphia, Pennsylvania, USA
Corresponding Author Joseph W. St. Geme III
ContactThe Children's Hospital of Philadelphia, Philadelphia, Pennsylvania, USA University of Pennsylvania Perelman School of Medicine, Philadelphia, Pennsylvania, USA