ProGP516

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP516
Validation Status Characterized
Organism Information
Organism NameAggregatibacter aphrophilus
Domain Bacteria
Classification Family: Pasteurellaceae
Order: Pasteurellales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 714
Genome Sequence(s)
GenBank AY344064.1
EMBL AY344064.1
Gene Information
Gene NameemaA
GenBank Gene Sequence AY344064.1
Protein Information
Protein NameEmaA
NCBI RefSeq AAQ22366.1
EMBL-CDSAAQ22366.1.
UniProtKB Sequence >WP_065336528.1 adhesin [Aggregatibacter aphrophilus] MNKVFKVIWCKASQTWIAVSELSKAFSLSTTTETPKKSLNSSNKTKIFIASIPLLFSFNVNAYIAIGSVE KNTIKSDGAEAAPRKNNSGSQVLNYYNPGSKSYDDKDKPNNTDRRYSEDDAYGIAIGKNTDVRDSRRDSN GIALGDHSKATGGLAMALGSFAKAEKNGGVAIGTASRSAGINSLAMMRQSAATGDYSTAIGSVAWAAGKS SFALGASATAKGNQSIAIGSLEQKVSPSGSGVPITKYNGLDNTQTNGDRSMALGTAAKTNGDDSFAIGYK AHTGEFKIEHDNYLKENVTSPEQSKKANKAIAVGTRALAQKESSIAFGYEASSLGVNAISIGANAKAAKD NVVAIGQGATATESGSMAIGQGAQSTFKNSLALGTGTVVNHVDGGQSKFTSQNYDVENGVISIANVGKER RIINLAAGRNDTDAVNVAQLQYVNKNLAKSIGGDNYTGYSDADGHTYQAPVFNIKNAQYNNVKAAVEAAQ TNYVSVNSSNKASDSNYDNKGAKAAGSIALGDTTSTGATATNSIAIGLNTSVTGSNTVAIGAGITATTSG SVVLGDSSSTEGSHPTASVNSATVNGHTYNGFAGAVKDAGHFVSVGSKGTERQIKNVAAGHVAADSTDAI NGSQLFSVASRIEQGFGLEAEEGGSVNKKLGQNVKVVGANSNIKTSVSNGEVKINLNNTLDLGSSGSIKI GDTLLNNNGLAITNGPTITSAGINAGNKKITGVAEGTEDNDAVNFKQLKNVLGGAVSTEIVEKKAAQAGD ENLADITVADGKNAGDMGAKYEVSVSKKAVQKAAQDAIKVSGTSPITVNKTTDNGVDDYAVSFNGTEAAK SIPLTYKANGNNDKTVMLNKGLNFTDGTMTTASVANDGVVKYDVNLSTIKVENGKAAVAGTPVNGANGTD GKDGVATVQNVVDALNKAAWTVAASKSEGEVAGNASKEVKNGDTVTYDAGKNIKITQNDKKFSFATKDDV EFTSVTTGNTKLTTNGVEITNGPKLTQAGIDAGNKKITDVADGNVAAGSKDAVNGGQLFAETAKAKTTVD KGDENIQITPETATDGHTNYKVALKPSLTVGPKESGHPITINGNDGHITGLTNKDWTGTPTSGRAATEDQ LSVVDKKFDNKVSLGGDNGSTTEKALSNTGGIKFNIKGGDSQKYVTTTASSDDVTVDLAQATKDKIDNAA DKNLSNITNDGKKAITGLGSIVEAADNTITVTNETNNVTGQKTYKIKANIPKPEKTVMAPGKNTVLDGDG SAANPFKVDLKDNLELGQKDANGVTGKDSSIKVNGKDGSSVAINGKDGSITLNGKDGANPVSLKTTQGPA GLNGTTPKDRLTVNNESVATLEDGLQFAGDNGTDKVINKKLNQKLEIVGGADKTKLSDNNIGVNANNGKL EVKLAKELNNLTSAQFKDGDNTTVINGKGMTITPKDPAKAVSVTDKGLNNGGNQIVNIDSGLKQANGSTV ALKDASGNTLKNAVNVGDLQKSINDITDVNKNGGFGLADEKGTTAKANLGETVKVKGDGSITTRVVNDNG KPALQVGLAKDVTVGDNTNPGTITVKGENGKNGVSINGKEGSIGLNGKDGANASITVAQGKAGVDGKDGE SKTRITYETTNPDGSKNSEQVATLNDGMKFVGNDGKVVTRKLNDTLSITGGINDQAVLADNQQVSGNNIG VRYKKQGGLEMVMKERPEFSGVVVNGKDGKDASVTFAKDGKDGMSLVGGRDAKGKDAITIKGKDGKDGVS FKEDGRITNVADGVDDKDAVNKSQLDKSIAQAKSNVNAGKNITVTPQKNADGSTTYTVETKDDVEFTSVK SGDTTMDNNGISITGGPSVTKDGINASDKKITGVKDGDISATSKDAVNGSQLHQTNQNVNNLTTTVNKGL NFQGDNQEVTVNRKLGDQLNIRGGANPKKLTQNNIGVVADKNGTMTVQMAKDVNLGPDGSLTVGNTTVNN DGIAIKGGPSMTQSGINAGGKRISNVARGKAPNDAVNMSQLHEVGNAINNRIDNIDNRVNKMDKRRKAGT ASALATAGLMQPHRDGQSALVAAVGQYQDETAVAVGYSRISDNGKYGVKVSFSTNSRGEVGGTAGAGYFW
Sequence length 1965 AA
Subcellular LocationOuter membrane
Function Trimeric autotransporter protein, pathogenesis
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN687, N819, N834, N907, N1140 and N1592
Glycosite(s) Annotated Protein Sequence >WP_065336528.1 adhesin [Aggregatibacter aphrophilus] MNKVFKVIWCKASQTWIAVSELSKAFSLSTTTETPKKSLNSSNKTKIFIASIPLLFSFNVNAYIAIGSVE KNTIKSDGAEAAPRKNNSGSQVLNYYNPGSKSYDDKDKPNNTDRRYSEDDAYGIAIGKNTDVRDSRRDSN GIALGDHSKATGGLAMALGSFAKAEKNGGVAIGTASRSAGINSLAMMRQSAATGDYSTAIGSVAWAAGKS SFALGASATAKGNQSIAIGSLEQKVSPSGSGVPITKYNGLDNTQTNGDRSMALGTAAKTNGDDSFAIGYK AHTGEFKIEHDNYLKENVTSPEQSKKANKAIAVGTRALAQKESSIAFGYEASSLGVNAISIGANAKAAKD NVVAIGQGATATESGSMAIGQGAQSTFKNSLALGTGTVVNHVDGGQSKFTSQNYDVENGVISIANVGKER RIINLAAGRNDTDAVNVAQLQYVNKNLAKSIGGDNYTGYSDADGHTYQAPVFNIKNAQYNNVKAAVEAAQ TNYVSVNSSNKASDSNYDNKGAKAAGSIALGDTTSTGATATNSIAIGLNTSVTGSNTVAIGAGITATTSG SVVLGDSSSTEGSHPTASVNSATVNGHTYNGFAGAVKDAGHFVSVGSKGTERQIKNVAAGHVAADSTDAI NGSQLFSVASRIEQGFGLEAEEGGSVNKKLGQNVKVVGANSNIKTSVSNGEVKINLN*(687)NTLDLGSSGSIKI GDTLLNNNGLAITNGPTITSAGINAGNKKITGVAEGTEDNDAVNFKQLKNVLGGAVSTEIVEKKAAQAGD ENLADITVADGKNAGDMGAKYEVSVSKKAVQKAAQDAIKVSGTSPITVN*(819)KTTDNGVDDYAVSFN*(834)GTEAAK SIPLTYKANGNNDKTVMLNKGLNFTDGTMTTASVANDGVVKYDVNLSTIKVENGKAAVAGTPVNGAN*(907)GTD GKDGVATVQNVVDALNKAAWTVAASKSEGEVAGNASKEVKNGDTVTYDAGKNIKITQNDKKFSFATKDDV EFTSVTTGNTKLTTNGVEITNGPKLTQAGIDAGNKKITDVADGNVAAGSKDAVNGGQLFAETAKAKTTVD KGDENIQITPETATDGHTNYKVALKPSLTVGPKESGHPITINGNDGHITGLTNKDWTGTPTSGRAATEDQ LSVVDKKFDNKVSLGGDN*(1140)GSTTEKALSNTGGIKFNIKGGDSQKYVTTTASSDDVTVDLAQATKDKIDNAA DKNLSNITNDGKKAITGLGSIVEAADNTITVTNETNNVTGQKTYKIKANIPKPEKTVMAPGKNTVLDGDG SAANPFKVDLKDNLELGQKDANGVTGKDSSIKVNGKDGSSVAINGKDGSITLNGKDGANPVSLKTTQGPA GLNGTTPKDRLTVNNESVATLEDGLQFAGDNGTDKVINKKLNQKLEIVGGADKTKLSDNNIGVNANNGKL EVKLAKELNNLTSAQFKDGDNTTVINGKGMTITPKDPAKAVSVTDKGLNNGGNQIVNIDSGLKQANGSTV ALKDASGNTLKNAVNVGDLQKSINDITDVNKNGGFGLADEKGTTAKANLGETVKVKGDGSITTRVVNDNG KPALQVGLAKDVTVGDNTNPGTITVKGENGKNGVSINGKEGSIGLNGKDGAN*(1592)ASITVAQGKAGVDGKDGE SKTRITYETTNPDGSKNSEQVATLNDGMKFVGNDGKVVTRKLNDTLSITGGINDQAVLADNQQVSGNNIG VRYKKQGGLEMVMKERPEFSGVVVNGKDGKDASVTFAKDGKDGMSLVGGRDAKGKDAITIKGKDGKDGVS FKEDGRITNVADGVDDKDAVNKSQLDKSIAQAKSNVNAGKNITVTPQKNADGSTTYTVETKDDVEFTSVK SGDTTMDNNGISITGGPSVTKDGINASDKKITGVKDGDISATSKDAVNGSQLHQTNQNVNNLTTTVNKGL NFQGDNQEVTVNRKLGDQLNIRGGANPKKLTQNNIGVVADKNGTMTVQMAKDVNLGPDGSLTVGNTTVNN DGIAIKGGPSMTQSGINAGGKRISNVARGKAPNDAVNMSQLHEVGNAINNRIDNIDNRVNKMDKRRKAGT ASALATAGLMQPHRDGQSALVAAVGQYQDETAVAVGYSRISDNGKYGVKVSFSTNSRGEVGGTAGAGYFW
Sequence Around Glycosites (21 AA) VSNGEVKINLNNTLDLGSSGS
KVSGTSPITVNKTTDNGVDDY
NGVDDYAVSFNGTEAAKSIPL
AVAGTPVNGANGTDGKDGVAT
FDNKVSLGGDNGSTTEKALSN
SIGLNGKDGANASITVAQGKA
Glycosite Sequence Logo
Technique(s) used for Glycosylated Residue(s) Detection Mass spectrometry analysis
Glycan Information
Glycan Annotation Single hexose at all each site.
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT87
Characterized Accessory Gene(s)hmw1CAa
Literature
Year of Identification2015
Year of Identification Month Wise2015.8.25
Year of Validation 2015
ReferenceKatherine A. Rempe, Lynn A. Spruce, Eric A. Porsch, Steven H. Seeholzer, Niels Nørskov-Lauritsen,Joseph W. St. Geme III ( 2015). Unconventional N-Linked Glycosylation Promotes Trimeric Autotransporter Function in Kingella kingae and Aggregatibacter aph
AuthorKatherine A. Rempe, Lynn A. Spruce, Eric A. Porsch, Steven H. Seeholzer, Niels Nørskov-Lauritsen,Joseph W. St. Geme III
Research GroupThe Children's Hospital of Philadelphia, Philadelphia, Pennsylvania, USA University of Pennsylvania Perelman School of Medicine, Philadelphia, Pennsylvania, USA
Corresponding Author Joseph W. St. Geme III
ContactThe Children's Hospital of Philadelphia, Philadelphia, Pennsylvania, USA University of Pennsylvania Perelman School of Medicine, Philadelphia, Pennsylvania, USA