ProGP52

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP52
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Sequence(s)
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene Nameslp1 (SSO0389)
NCBI Gene ID 27426684
GenBank Gene Sequence NZ_LT549890.1
Protein Information
Protein NameHypothetical protein
UniProtKB/SwissProt ID Q980C7
NCBI RefSeq WP_010922960.1
EMBL-CDSAAK40716.1
UniProtKB Sequence >tr|Q980C7|Q980C7_SULSO Surface layer glycoprotein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=slp1 PE=4 SV=1 MNKTLGLILTSVFLLSTLGIITGFVIPTQAANSNDAAIYTIPSVTSVSNTSNIVINLFFN ATSNSTVGAQASAFNYGLAINYTLDAITFTVVLPSGTSYPLIKLNAKNFANYGYYDLAHN SIVLLLNTTASSTAKELAYSYEQSIGVTPSASYKIYNYTNKTVNVNQYMNELPLSMLIYM ATNGKYNNLASLPVGTKLEFTYAGVTYIIAVSPTVKLVGELLNPLYTANSKMLPGTNYAV GRSNITVAVYDNLITTTTSPFNFTLTYSSLAPALIYWFVIANTTYTNNGASTPTASFQAP PFKQYFPSNSTILYSAAPTKSSILMFNGQMNVTAHENVTLTLQTGTNIYTSPNFNVTPPG NYTFSGKLGVGFNGFIYQNGSATLTATIFNGTINFFFSSTGQKAAFTFFLVPIVPINLGD NNGATVIYNGVSLNTGFPQVVVMFNITGNFTKSGSNYLLYGSVYEAELKPLGSTQLQKLA GATDSTQFVGNLISSASSPLVSYFNYGESTTTITGTSLSFTVLMPLKFIVERLGYIYLVT FHIWGPSATVTVTGVDYHGTQIALGSFRAYVALPSFYTLPKTPLVGLTCDNMYTLAQVSD AGSVLETSTANSNANNATVIGPYDLMSNAGLHVAIYNGSKLVKSGNLGLLPNATTAPITT TITLNGQTVALTYSSAPTAIYPVDFKFEPGFSYSVTTNVIYNTSIPTYVVTVYMPLKYIL QTKIVMWYVSPDYAAYFYYSSTGQYQTSNVTLTFANVTPELVMPQVFPVGKLYMPFGIND PYYVFYSSISIGPQSGVIEAVENGFNVGNITSITVELNGMNESIVLSPLNVSKLLISSNL GEVSQCSPLFTTTLFNISALASLLGLPNAAALNGSYLYVTYHDIISGAYVTNRTLLVVGQ FYVMPPTTPGSVEWILTAKYINATTGIPVEISYAVVQQPSAKVVDINAANASITQIQVTG VKIVSKYATVTVMYNPSNASTIVYMNGMFVASYGGNLISSLSETSTFGVYYGAVVNLYVA TGTLSSPNGTMYVVLGSHKVAVGTANLYTYAGYHFGPYTALPLVSNVTFTVQDPVTHATL TGQTTLGAFNNTPIRLAPLGVSIPQTAQYKVFYYYSTPLVLSPTSQYIVLSVTSVISYPY PFYIETVSFLGYNVTTGTPVPGTPAFQTVYSPSLGPGVVLQVPVQSYQFISLSTPSEPHT VVMFAVPFAGGPAISLYPTFLVYANVTAISS
Sequence length 1231 AA
Subcellular LocationSurface
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN127, N157, N160, N197, N244, N616, N702, M922 and N1153
Glycosite(s) Annotated Protein Sequence >tr|Q980C7|Q980C7_SULSO Surface layer glycoprotein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=slp1 PE=4 SV=1 MNKTLGLILTSVFLLSTLGIITGFVIPTQAANSNDAAIYTIPSVTSVSNTSNIVINLFFN(50) ATSNSTVGAQASAFNYGLAINYTLDAITFTVVLPSGTSYPLIKLNAKNFANYGYYDLAHN SIVLLLN*(127)TTASSTAKELAYSYEQSIGVTPSASYKIYN*(157)YTN*(160)KTVNVNQYMNELPLSMLIYM ATNGKYNNLASLPVGTKLEFTYAGVTYIIAVSPTVKLVGELLNPLYTANSKMLPGTN*(197)YAV GRSN*(244)ITVAVYDNLITTTTSPFNFTLTYSSLAPALIYWFVIANTTYTNNGASTPTASFQAP PFKQYFPSNSTILYSAAPTKSSILMFNGQMNVTAHENVTLTLQTGTNIYTSPNFNVTPPG NYTFSGKLGVGFNGFIYQNGSATLTATIFNGTINFFFSSTGQKAAFTFFLVPIVPINLGD NNGATVIYNGVSLNTGFPQVVVMFNITGNFTKSGSNYLLYGSVYEAELKPLGSTQLQKLA GATDSTQFVGNLISSASSPLVSYFNYGESTTTITGTSLSFTVLMPLKFIVERLGYIYLVT FHIWGPSATVTVTGVDYHGTQIALGSFRAYVALPSFYTLPKTPLVGLTCDNMYTLAQVSD AGSVLETSTANSNANN*(616)ATVIGPYDLMSNAGLHVAIYNGSKLVKSGNLGLLPNATTAPITT TITLNGQTVALTYSSAPTAIYPVDFKFEPGFSYSVTTNVIYN*(702)TSIPTYVVTVYMPLKYIL QTKIVMWYVSPDYAAYFYYSSTGQYQTSNVTLTFANVTPELVMPQVFPVGKLYMPFGIND PYYVFYSSISIGPQSGVIEAVENGFNVGNITSITVELNGMNESIVLSPLNVSKLLISSNL GEVSQCSPLFTTTLFNISALASLLGLPNAAALNGSYLYVTYHDIISGAYVTNRTLLVVGQ FYVMPPTTPGSVEWILTAKYIN*(922)ATTGIPVEISYAVVQQPSAKVVDINAANASITQIQVTG VKIVSKYATVTVMYNPSNASTIVYMNGMFVASYGGNLISSLSETSTFGVYYGAVVNLYVA TGTLSSPNGTMYVVLGSHKVAVGTANLYTYAGYHFGPYTALPLVSNVTFTVQDPVTHATL TGQTTLGAFNNTPIRLAPLGVSIPQTAQYKVFYYYSTPLVLSPTSQYIVLSVTSVISYPY PFYIETVSFLGYN*(1153)VTTGTPVPGTPAFQTVYSPSLGPGVVLQVPVQSYQFISLSTPSEPHT VVMFAVPFAGGPAISLYPTFLVYANVTAISS
Sequence Around Glycosites (21 AA) LAHNSIVLLLNTTASSTAKEL
VTPSASYKIYNYTNKTVNVNQ
TANSKMLPGTNYAVGRSNITV
SASYKIYNYTNKTVNVNQYMN
PGTNYAVGRSNITVAVYDNLI
ETSTANSNANNATVIGPYDLM
VEWILTAKYINATTGIPVEIS
YIETVSFLGYNVTTGTPVPGT
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionThymol-sulfuric acid staining, Concanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification1989
Year of Identification Month Wise1989.09.14
Year of Validation 2013
ReferenceGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779?2790.
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Reference1) Grogan, D.W. (1989) Phenotypic characterization of the archaebacterial genus Sulfolobus: comparison of five wild-type strains. J Bacteriol, 171, 6710-6719. [PubMed: 2512283]
Author Grogan, D.W.
Research GroupMax Planck Institute for Biochemistry, Martinsried, Federal Republic of Germany.
Corresponding Author Grogan, D.W.
ContactMax Planck Institute for Biochemistry, Martinsried, Federal Republic of Germany.