ProGP521 (EF-P)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP521 (EF-P)
Validation Status Characterized
Organism Information
Organism NameNeisseria meningitidis C311 and MC58
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 491
Genome Information
GenBank AE002098.2
EMBL AE002098
Organism Additional Information Neisseria meningitidis (Gram-negative bacterium) is the causative agent of cerebrospinal meningitis. Sometimes, it crosses the epithelium using its pili to enter the bloodstream. After rapid proliferation, this leads to septicemia. It also crosses the blood-brain barrier to proliferate in the brain.
Gene Information
Gene NameNMB0937
GenBank Gene Sequence NC_003112.2
Protein Information
Protein NameEF-P
UniProtKB/SwissProt ID Q9JZQ8
NCBI RefSeq NP_273975.1
EMBL-CDSAAF41343.2
UniProtKB Sequence >sp|Q9JZQ8|EFP_NEIMB Elongation factor P OS=Neisseria meningitidis serogroup B (strain MC58) GN=efp PE=3 SV=1 MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGRSSAKVSMKLKNLLTGAASETIYKADDKF DVVILSRKNCTYSYFADPMYVFMDEEFNQYEIEADNIGDALKFIVDGMEDQCEVTFYEGN PISVELPTIIVREVEYTEPAVKGDTSGKVMKTARLVGGTEIQVMSYIENGDKVEIDTRTG EFRKRA
Sequence length 186 AA
Subcellular LocationCytoplasm
Glycosylation Status
Glycosylation Type N- (Arg) linked
Experimentally Validated Glycosite(s) in Full Length ProteinR32
Glycosite(s) Annotated Protein Sequence >tr|X5F6D0|X5F6D0_NEIME Elongation factor P OS=Neisseria meningitidis GN=efp PE=3 SV=1 MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGR*(32)SSAKVSMKLKNLLTGAASETIYKADDKF DVVILSRKNCTYSYFADPMYVFMDEEFNQYEIEADNIGDALKFIVDGMEDQCEVTFYEGN PISVELPTIIVREVEYTEPAVKGDTSGKVMKTARLVGGTEIQVMSYIENGDKIEIDTRTG EFRKRA
Sequence Around Glycosites (21 AA) VQKTEYIKGGRSSAKVSMKLKN
Technique(s) used for Glycosylated Residue(s) Detection MALDI-TOF MS/MS
Protein Glycosylation- Implication The rhamnosylated EF-P(Nm), but not the unmodified EF-P(Nm), restores the growth rate of EF-P-deleted E. coli cells to the wild-type level
Glycan Information
Glycan Annotation Monosaccharide (rhamnose)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameEarP
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
Year of Validation 2016
ReferenceYanagisawa T,Takahashi H, Suzuki T, Masuda A, Dohmae N, Yokoyama S,(2016)Neisseria meningitidis Translation Elongation Factor P and Its Active-Site Arginine Residue Are Essential for Cell Viability. PLoS One, 11(2):e0147907. [PubMed:26840407]
AuthorYanagisawa T,Takahashi H, Suzuki T, Masuda A, Dohmae N, Yokoyama S,
Research Group1 RIKEN Structural Biology Laboratory, 1-7-22 Suehiro-cho, Tsurumi, Yokohama 230-0045, Japan. 2 RIKEN Systems and Structural Biology Center, 1-7-22 Suehiro-cho, Tsurumi, Yokohama 230-0045, Japan. 3 National Institute of Infectious Disease, Department of Bacteriology, 1-23-1 Toyama, Shinjuku-ku, Tokyo 162-8640, Japan. 4 RIKEN Center for Sustainable Resource Science (CSRS), 2-1 Hirosawa, Wako, Saitama 351-0198, Japan. 5 National Maritime Research Institute, 6-38-1 Shinkawa, Mitaka, Tokyo 181-0004, Japan.
Corresponding Author Yokoyama S
ContactRIKEN Systems and Structural Biology Center, 1-7-22 Suehiro-cho, Tsurumi, Yokohama 230-0045, Japan