ProGP521

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP521
Validation Status Characterized
Organism Information
Organism NameHaloarcula hispanica
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 634497
Genome Sequence(s)
GenBank CP002921.1
EMBL CP002921.1
Organism Additional Information H. hispanica, a halophilic archaeon, is extraordinary among members of the Halobacteriaceae in that it displays particularly low restriction activity and is therefore important as one of the most tractable haloarchaea for archaeal genetic research. The membrane contains a high content of carotenoid pigments (bacterioruberin) which give red pigmentation to the cells. It needs at least 3.4 M NaCl (higher than that needed by H. volcanii) for good growth.
Gene Information
Gene NameHah_1992
GenBank Gene Sequence NC_023013.1
Protein Information
Protein NameSlg2 (S-layer glycoprotein)
UniProtKB/SwissProt ID G0HV86
NCBI RefSeq WP_014040753.1
EMBL-CDSAEM57588.1
UniProtKB Sequence >tr|G0HV86|G0HV86_HALHT Uncharacterized protein OS=Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755) GN=HAH_1992 PE=4 SV=1 MTGNSDKVRSLFLTALMVFSVFAGTIAFSGGAAAAANVSVQQAAEYDSGTVELALNGSTG SPVTTGDINIYIDGNENPSNYGVSSVDTTDDGTTGRLQFSLDQDVQPNRNLTVEVSGLTG GDNTVVAEDIDVTSQTIDADDDSGDTNAFRGEVLAIRADGGEGDADDATSSTQIVVEDSN GAVVTQDTYTANSKVYTYETENLDTGEEYEVTVGGTADENITISNLDLNVNIDDDVGDGA NIDDTDTLAVNVSTTRGGEPANATLFNEDDDKVATQIKSLKGNENVVFDFGNQSADDSPY YVKVTDNQTGVSAESDQINVSESGEGDASFETSTVQDEVGDVTNITVQMGNTENAVINVG SQNDDNYVIQGQLEDDNGDGEVTVQFNSYTAGTDNNNTVLTVPGDDDLDEVEEKGSFTDS RNSLDEDVLEPQSYSINVTAGTSPDVTSPDTVGTLRLNENSVESMQTWVAPSDADIDDED IDIYDRIGENLTQSDDVAVEDVVVHEIQASGIEGALEYEQEDNGSSDVTDAFIAAADTTP DRINDDTSASGLQLYVNRTDVGANADADPINFANSSSAVTVVDDPDNNTYFVALDTEDVE FESGNTITEEEDTEINATFSVQEGPLTDDSSSESELYTTSERNAELNLDDDGFVTVGAAA GQTVSGDTNVAPGSELEVEMESESEANPFVERPEATVGPNGTYVATEDFSDYSAGTNFTV QTLDVDGDSDFSDEEDGRIVEADTATVSISDQESDGSEVVVDSAQLSSGGFIAIHAGDAS GDVVGNSEYLEAGTYNDLTITLDEPMDENFTAVAMPHQDTNGNEEYDFPGDDGPYTQNGS AVTDSANVTVSAEEPEDTPEDTPEDTPEDTPEDTPEDTPADTPEDTPDTGTETTEAEGPG FTAAIALIALVAAALLAVRRDN
Sequence length 922 AA
Function The number and similarity of the S-layer glycoproteins may be used as a potential taxonomic marker for halophilic archaea. In addition to this, S-layer glycoproteins might be helpful as reporter molecules for studying the origin and evolution of archaea.
Glycosylation Status
Glycosylation Type N (Asn) and O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN307 and T858 or T862 or T866 or T870 or T874 or T882 or all T residues in six repeats of DTPE at C-terminal end.
Glycosite(s) Annotated Protein Sequence >tr|G0HV86|G0HV86_HALHT Uncharacterized protein OS=Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755) GN=HAH_1992 PE=4 SV=1 MTGNSDKVRSLFLTALMVFSVFAGTIAFSGGAAAAANVSVQQAAEYDSGTVELALNGSTG SPVTTGDINIYIDGNENPSNYGVSSVDTTDDGTTGRLQFSLDQDVQPNRNLTVEVSGLTG GDNTVVAEDIDVTSQTIDADDDSGDTNAFRGEVLAIRADGGEGDADDATSSTQIVVEDSN GAVVTQDTYTANSKVYTYETENLDTGEEYEVTVGGTADENITISNLDLNVNIDDDVGDGA NIDDTDTLAVNVSTTRGGEPANATLFNEDDDKVATQIKSLKGNENVVFDFGNQSADDSPY YVKVTDN*(307)QTGVSAESDQINVSESGEGDASFETSTVQDEVGDVTNITVQMGNTENAVINVG SQNDDNYVIQGQLEDDNGDGEVTVQFNSYTAGTDNNNTVLTVPGDDDLDEVEEKGSFTDS RNSLDEDVLEPQSYSINVTAGTSPDVTSPDTVGTLRLNENSVESMQTWVAPSDADIDDED IDIYDRIGENLTQSDDVAVEDVVVHEIQASGIEGALEYEQEDNGSSDVTDAFIAAADTTP DRINDDTSASGLQLYVNRTDVGANADADPINFANSSSAVTVVDDPDNNTYFVALDTEDVE FESGNTITEEEDTEINATFSVQEGPLTDDSSSESELYTTSERNAELNLDDDGFVTVGAAA GQTVSGDTNVAPGSELEVEMESESEANPFVERPEATVGPNGTYVATEDFSDYSAGTNFTV QTLDVDGDSDFSDEEDGRIVEADTATVSISDQESDGSEVVVDSAQLSSGGFIAIHAGDAS GDVVGNSEYLEAGTYNDLTITLDEPMDENFTAVAMPHQDTNGNEEYDFPGDDGPYTQNGS AVTDSANVTVSAEEPEDT*(858)PEDT*(862)PEDT*(866)PEDT*(870)PEDT*(874)PEDTPADTPEDT*(884)PDTGTETTEAEGPG FTAAIALIALVAAALLAVRRDN
Sequence Around Glycosites (21 AA) DSPYYVKVTDNQTGVSAESDQ
GSAVTDSANVTVSAEEPEDTP
VTVSAEEPEDTPEDTPEDTPE
AEEPEDTPEDTPEDTPEDTPE
EDTPEDTPEDTPEDTPEDTPE
EDTPEDTPEDTPEDTPEDTPA
EDTPEDTPEDTPEDTPADTPE
EDTPEDTPADTPEDTPDTGTE
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff staining, ConA binding and TFMS deglycosylation
Technique(s) used for Glycosylated Residue(s) Detection MALDI-TOF MS and MS/MS
Glycan Information
Glycan Annotation N-glycan was identified as a branched trisaccharide containing a 225 Da residue which corresponds to a 2-amino-6-sulfo-2, 6-dideoxy-quinovose. Glcα-1,4-Gal disaccharide was identified as the O-glycan. Acidic trisaccharides linked to N307.
Technique(s) used for Glycan Identification ESI–MS, MALDI-TOF, MS/MS after aminobenzamide (2-AB) labeling and NMR (DQF-COSY, HSQC, TOCSY and HMBC)
Literature
Additional CommentThis is the first time that a naturally occurring form of sulfoquinovosamine has been identified.
Year of Identification2015
Year of Identification Month Wise2015.11.1
Year of Validation 2015
ReferenceLu H, Lü Y, Ren J, Wang Z, Wang Q, Luo Y, Han J, Xiang H, Du Y, Jin C. (2015) Identification of the S-layer glycoproteins and their covalently linked glycans in the halophilic archaeon Haloarcula hispanica. Glycobiology, 25(11):1150-62.
AuthorLu H1, Lü Y2, Ren J2, Wang Z3, Wang Q4, Luo Y4, Han J4, Xiang H4, Du Y5, Jin C6.
Research Group1 State Key Laboratory of Mycology University of Chinese Academy of Sciences, Beijing 100101, China. 2 State Key Laboratory of Mycology. 3 Educational Ministry Key Laboratory of Resource Biology and Biotechnology in Western China, Life Science College, Northwest University, Xi'an 710069, China. 4 State Key Laboratory of Microbial Resources, Institute of Microbiology, Chinese Academy of Sciences, Beijing 100101, China. 5 Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085, China. 6 State Key Laboratory of Mycology
Corresponding Author Jin C
ContactState Key Laboratory of Mycology