ProGP523

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP523
Validation Status Characterized
Organism Information
Organism NameNeisseria meningitidis C311 and MC58
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Gene Information
Gene NameNMB0937
Protein Information
Protein NameEF-P
Glycosylation Status
Glycosylation Type N (Arg) linked
Experimentally Validated Glycosite(s) in Full Length ProteinArg32
Glycosite(s) Annotated Protein Sequence >tr|X5F6D0|X5F6D0_NEIME Elongation factor P OS=Neisseria meningitidis GN=efp PE=3 SV=1 MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGR*(32)SSAKVSMKLKNLLTGAASETIYKADDKF DVVILSRKNCTYSYFADPMYVFMDEEFNQYEIEADNIGDALKFIVDGMEDQCEVTFYEGN PISVELPTIIVREVEYTEPAVKGDTSGKVMKTARLVGGTEIQVMSYIENGDKIEIDTRTG EFRKRA
Sequence Around Glycosites (21 AA) VQKTEYIKGGRSSAKVSMKLKN
Glycosite Sequence Logo
Technique(s) used for Glycosylated Residue(s) Detection MALDI-TOF MS/MS
Protein Glycosylation- Implication The rhamnosylated EF-P(Nm), but not the unmodified EF-P(Nm), restores the growth rate of EF-P-deleted E. coli cells to the wild-type level
Glycan Information
Glycan Annotation Monosaccharide (rhamnose)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameEarP
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
Year of Validation 2016
ReferenceYanagisawa T,Takahashi H, Suzuki T, Masuda A, Dohmae N, Yokoyama S,(2016)Neisseria meningitidis Translation Elongation Factor P and Its Active-Site Arginine Residue Are Essential for Cell Viability. PLoS One. 2016 Feb 3;11(2):e0147907. doi: 10.1371/journal.pone.0147907. eCollection 2016.
AuthorYanagisawa T,Takahashi H, Suzuki T, Masuda A, Dohmae N, Yokoyama S,
Research GroupRIKEN Systems and Structural Biology Center, 1-7-22 Suehiro-cho, Tsurumi, Yokohama 230-0045, Japan
Corresponding Author Yokoyama S
ContactRIKEN Systems and Structural Biology Center, 1-7-22 Suehiro-cho, Tsurumi, Yokohama 230-0045, Japan