ProGP525

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP525
Validation Status Characterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Sequence(s)
GenBank NC_003295.1
EMBL AL646053.1
Gene Information
Gene NameRSp1038
GenBank Gene Sequence AL646053.1
Protein Information
Protein NameProbable lipoprotein transmembrane
UniProtKB/SwissProt ID Q8XR30
NCBI RefSeq CAD18189.1
EMBL-CDSCAD18189.1
UniProtKB Sequence >tr|Q8XR30|Q8XR30_RALSO Probable lipoprotein transmembrane OS=Ralstonia solanacearum (strain GMI1000) GN=RSp1038 PE=4 SV=1 MLATACAALALAACGWGIFPNSTGARMADDALLTYQVKAALDQDSALDARQIRIASTPDG HVILTGWVDTPEMARRAGEDVKRFVDRAKLDNRLRALSHPPGINSGPMIAPGLSPDQPAS APAAR
Sequence length 125 AA
Subcellular Location transmembrane
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS120
Glycosite(s) Annotated Protein Sequence >tr|Q8XR30|Q8XR30_RALSO Probable lipoprotein transmembrane OS=Ralstonia solanacearum (strain GMI1000) GN=RSp1038 PE=4 SV=1 MLATACAALALAACGWGIFPNSTGARMADDALLTYQVKAALDQDSALDARQIRIASTPDG HVILTGWVDTPEMARRAGEDVKRFVDRAKLDNRLRALSHPPGINSGPMIAPGLSPDQPAS*(120) APAAR
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection ZIC-HILIC
Technique(s) used for Glycosylated Residue(s) Detection LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide (HexNAc-(Pen)-dHex3)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT103
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
Year of Validation 2016
ReferenceElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228]
AuthorElhenawy W1, Scott NE2, Tondo ML3, Orellano EG3, Foster LJ2, Feldman MF4.
Research Group1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Facultad de Ciencias Bioquímicas y Farmacéuticas (FBIOYF-UNR), Instituto de Biología Molecular y Celular de Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA
Corresponding Author  Feldman MF
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA