ProGP527 (Probable tpr domain signal peptide prote

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP527 (Probable tpr domain signal peptide prote
Validation Status Characterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Information
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameRSc1166
NCBI Gene ID 1219981
GenBank Gene Sequence NC_003295.1
Protein Information
Protein NameProbable tpr domain signal peptide protein
UniProtKB/SwissProt ID Q8Y078
NCBI RefSeq WP_011001116.1
EMBL-CDSCAD14868.1
UniProtKB Sequence >tr|Q8Y078|Q8Y078_RALSO Probable tpr domain signal peptide protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1166 PE=4 SV=1 MNSTLRCRALGAALTGLIAMTTAPAFAQTAAPGIALPADLTPNTPQPPQVARQKRIDEWL ARKQYAQALAELDKDVATQPRNAQARFQRAVALAGLGRSDDAVVAFSQMTQDFPELPEPY LNLATLYAERGELLRARETLITATRVAPENAQAQANLGDIYVRLAAQSYQNALRLSPKHA AARARLDALPDLPGMRAVPSKPAAEPPAASGVNARPAKR
Sequence length 219 AA
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS210
Glycosite(s) Annotated Protein Sequence >tr|Q8Y078|Q8Y078_RALSO Probable tpr domain signal peptide protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1166 PE=4 SV=1 MNSTLRCRALGAALTGLIAMTTAPAFAQTAAPGIALPADLTPNTPQPPQVARQKRIDEWL ARKQYAQALAELDKDVATQPRNAQARFQRAVALAGLGRSDDAVVAFSQMTQDFPELPEPY LNLATLYAERGELLRARETLITATRVAPENAQAQANLGDIYVRLAAQSYQNALRLSPKHA AARARLDALPDLPGMRAVPS*(210)KPAAEPPAASGVNARPAKR
Sequence Around Glycosites (21 AA) SKPAAEPPAASGVNARPAKR
Technique(s) used for Glycosylation DetectionZIC-HILIC
Technique(s) used for Glycosylated Residue(s) Detection LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide (HexNAc-(Pen)-dHex3)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT104 (PglLRs)
Literature