ProGP527

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP527
Validation Status Characterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Sequence(s)
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameRSc2491
NCBI Gene ID 1221338
GenBank Gene Sequence NC_003295.1
Protein Information
Protein NameHypothetical signal peptide protein
UniProtKB/SwissProt ID Q8XWI3
NCBI RefSeq WP_011002408.1
EMBL-CDSCAD16198.1
UniProtKB Sequence >tr|Q8XWI3|Q8XWI3_RALSO Hypothetical signal peptide protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2491 PE=4 SV=1 MKKLIAALIAGLFATGVFAQASAPAAEAAAPAAEKAAPKKAKKAKKHHAKKEKAAAADAA SAPAAKQ
Sequence length 67 AA
Function Hypothetical signal peptide protein
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS61
Glycosite(s) Annotated Protein Sequence >tr|Q8XWI3|Q8XWI3_RALSO Hypothetical signal peptide protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2491 PE=4 SV=1 MKKLIAALIAGLFATGVFAQASAPAAEAAAPAAEKAAPKKAKKAKKHHAKKEKAAAADAA S*(61)APAAKQ
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection ZIC-HILIC
Technique(s) used for Glycosylated Residue(s) Detection LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide (HexNAc-(Pen)-dHex3)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT103
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
Year of Validation 2016
ReferenceElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228]
AuthorElhenawy W1, Scott NE2, Tondo ML3, Orellano EG3, Foster LJ2, Feldman MF4.
Research Group1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Facultad de Ciencias Bioquímicas y Farmacéuticas (FBIOYF-UNR), Instituto de Biología Molecular y Celular de Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA
Corresponding Author  Feldman MF
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA