ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrola

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrola
Validation Status Uncharacterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Information
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameRSc1334
NCBI Gene ID 1220158
GenBank Gene Sequence NC_003295.1
Protein Information
Protein NameD-(−)-3-hydroxybutyrate oligomer hydrolase
UniProtKB/SwissProt ID Q8XZR1
NCBI RefSeq WP_011001283.1
EMBL-CDSCAD15036.1
UniProtKB Sequence >sp|Q8XZR1|HBOH_RALSO D-(-)-3-hydroxybutyrate oligomer hydrolase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1334 PE=3 SV=1 MNTTRDANRLRQRASLSGLALAGSLGLAGCGVLGLAGCGGDNNSSTSGNVKPSFVGTVTV TRHDGANDDLLTAGLGAAGLASASAPSVATPTAPTAAELRRLDIYASYRALVDTAANGGY GTLYGPSVDVNGNATSGSGMVPGVEYIAYSDDGTGQQNVVLLVQIPDAFDPANPCIITAT SSGSRGIYGAISTGEWGLKHKCAVAYTDKGTGAGPHDLATDTVPLQDGTRTTRLAAGRTA QFAAPLTDSQLAAFNAATPNRLAFKHAHSQRNPEKDWGLFTLQAVQFAFWAINDKLGAAG MPAGSPLPVRRDNTIVIASSISNGGGAAIAAAEQDTAGWIDGVAVGEPGLNLPPSANVQV ARGGVTLPVSGKPLFDYVSYANLFRLCAASSSGVSAAPTQAFFAGAVGWPASVQANRCAA LRANGLLSSATAAAQADEALQKLHAFGWEPESDLVHASMSYFEIDPSVAVTFGNALARAS VLDNLCNFSFAAVDSAFHPTAVNATSLAQMAALGNGIPPTSGVQLINNLAQGGPTQSKQS VDGSGALAANLDGALCLRNLLTGGDAASLALQAGIAQTLRTGNLHGKPALIVQGRNDALL PVNHGARPYLGLNAQTDSSSRLSYIEVMNAQHFDGFIDLVPGYDTLFVPLVLYEQRALDA VFANLKNGTPLPPSQVVRTTPRGGTAGAAPAITAANVPNFTMTPAAGDRIGVSVSGGVAT VSVPN
Sequence length 725 AA
Function small molecule metabolism; degradation; carbon compounds, Participates in the degradation of poly-3-hydroxybutyrate (PHB). It works downstream of poly(3-hydroxybutyrate) depolymerase, hydrolyzing D--3-hydroxybutyrate oligomers of various length (3HB-oligomers) into 3HB-monomers
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT104 (PglLRs)
Literature