ProGP531

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP531
Validation Status Characterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Sequence(s)
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameacrA
NCBI Gene ID 1218813
GenBank Gene Sequence NC_003295.1
Protein Information
Protein NameAcrA
UniProtKB/SwissProt ID Q8Y3G9
NCBI RefSeq WP_010999978.1
EMBL-CDSCAD13539.1
UniProtKB Sequence >tr|Q8Y3G9|Q8Y3G9_RALSO Probable acriflavin resistance lipoprotein a OS=Ralstonia solanacearum (strain GMI1000) GN=acrA PE=3 SV=1 MSNTRRYHQLAAAGLTVVALAACGNKQAQGPGGGMPPTEVGVVTVQPHSVGLTTELPGRL EATRVAQVRARVAGIVLKRTYQEGSDVKANDVLFRIDPAQYQASLDSAKAQLARAEATQT QAQLKAERYKPLVATNAISKQDYDDAVAAAKQATADVGAARAAVETAKLNLGYATVTSPI SGRAGLAQVTEGALVGQGSDATLLATVQQIDPIYLTFTQSSTEVMRLQEALKAGKLAAAG DTAAKVTLVTEDGRVYAQTGKLYFSDLTVDQTTGSITLRAIFPNAERTLLPGMYVRARLE QAVDQQAITVPQQAVSRGADGASVMIVDAEGKVAPRPVQADRAVGTDWIVSSGLKAGDKV IVDGLQKVRPGAPVKPVAWQAGGAQGQGAAASAPAAKQ
Sequence length 398 AA
Function Probable acriflavin resistance lipoprotein
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS393
Glycosite(s) Annotated Protein Sequence >tr|Q8Y3G9|Q8Y3G9_RALSO Probable acriflavin resistance lipoprotein a OS=Ralstonia solanacearum (strain GMI1000) GN=acrA PE=3 SV=1 MSNTRRYHQLAAAGLTVVALAACGNKQAQGPGGGMPPTEVGVVTVQPHSVGLTTELPGRL EATRVAQVRARVAGIVLKRTYQEGSDVKANDVLFRIDPAQYQASLDSAKAQLARAEATQT QAQLKAERYKPLVATNAISKQDYDDAVAAAKQATADVGAARAAVETAKLNLGYATVTSPI SGRAGLAQVTEGALVGQGSDATLLATVQQIDPIYLTFTQSSTEVMRLQEALKAGKLAAAG DTAAKVTLVTEDGRVYAQTGKLYFSDLTVDQTTGSITLRAIFPNAERTLLPGMYVRARLE QAVDQQAITVPQQAVSRGADGASVMIVDAEGKVAPRPVQADRAVGTDWIVSSGLKAGDKV IVDGLQKVRPGAPVKPVAWQAGGAQGQGAAAS*(393)APAAKQ
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection ZIC-HILIC
Technique(s) used for Glycosylated Residue(s) Detection LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide (HexNAc-(Pen)-dHex3)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT103
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
Year of Validation 2016
ReferenceElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228]
AuthorElhenawy W1, Scott NE2, Tondo ML3, Orellano EG3, Foster LJ2, Feldman MF4.
Research Group1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Facultad de Ciencias Bioquímicas y Farmacéuticas (FBIOYF-UNR), Instituto de Biología Molecular y Celular de Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA
Corresponding Author  Feldman MF
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA