ProGP532

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP532
Validation Status Uncharacterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Sequence(s)
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameRSc1334
NCBI Gene ID 1220158
GenBank Gene Sequence NC_003295.1
Protein Information
Protein NameD-(−)-3-hydroxybutyrate oligomer hydrolase
UniProtKB/SwissProt ID Q8XZR1
NCBI RefSeq WP_011001283.1
EMBL-CDSCAD15036.1
UniProtKB Sequence >sp|Q8XZR1|HBOH_RALSO D-(-)-3-hydroxybutyrate oligomer hydrolase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1334 PE=3 SV=1 MNTTRDANRLRQRASLSGLALAGSLGLAGCGVLGLAGCGGDNNSSTSGNVKPSFVGTVTV TRHDGANDDLLTAGLGAAGLASASAPSVATPTAPTAAELRRLDIYASYRALVDTAANGGY GTLYGPSVDVNGNATSGSGMVPGVEYIAYSDDGTGQQNVVLLVQIPDAFDPANPCIITAT SSGSRGIYGAISTGEWGLKHKCAVAYTDKGTGAGPHDLATDTVPLQDGTRTTRLAAGRTA QFAAPLTDSQLAAFNAATPNRLAFKHAHSQRNPEKDWGLFTLQAVQFAFWAINDKLGAAG MPAGSPLPVRRDNTIVIASSISNGGGAAIAAAEQDTAGWIDGVAVGEPGLNLPPSANVQV ARGGVTLPVSGKPLFDYVSYANLFRLCAASSSGVSAAPTQAFFAGAVGWPASVQANRCAA LRANGLLSSATAAAQADEALQKLHAFGWEPESDLVHASMSYFEIDPSVAVTFGNALARAS VLDNLCNFSFAAVDSAFHPTAVNATSLAQMAALGNGIPPTSGVQLINNLAQGGPTQSKQS VDGSGALAANLDGALCLRNLLTGGDAASLALQAGIAQTLRTGNLHGKPALIVQGRNDALL PVNHGARPYLGLNAQTDSSSRLSYIEVMNAQHFDGFIDLVPGYDTLFVPLVLYEQRALDA VFANLKNGTPLPPSQVVRTTPRGGTAGAAPAITAANVPNFTMTPAAGDRIGVSVSGGVAT VSVPN
Sequence length 725 AA
Function small molecule metabolism; degradation; carbon compounds, Participates in the degradation of poly-3-hydroxybutyrate (PHB). It works downstream of poly(3-hydroxybutyrate) depolymerase, hydrolyzing D--3-hydroxybutyrate oligomers of various length (3HB-oligomers) into 3HB-monomers
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT103
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
ReferenceElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228]
AuthorElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF.
Research Group1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA
Corresponding Author  Feldman MF
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA