ProGP534

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP534
Validation Status Uncharacterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Sequence(s)
GenBank NC_003295.1
EMBL AL646053.1
Gene Information
Gene NameRSp0603
NCBI Gene ID 1222910
GenBank Gene Sequence NC_003296.1
Protein Information
Protein NameProbable serine protease protein
UniProtKB/SwissProt ID Q8XS78
NCBI RefSeq WP_011003901.1
EMBL-CDSCAD17754.1
UniProtKB Sequence >tr|Q8XS78|Q8XS78_RALSO Probable serine protease protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0603 PE=4 SV=1 MAQANASPSKPNGSPLPNIDGIPSGLPPKAKAEGNTAKLDGALIRLRQNTGTLHARSASG IESPAATRPGSCVNVDIAVQADARQTAAQLERLGLQDTAVYGNYISGCLPVANIDEAAAI AQIRRISKVARSTHSGVVQGQGDYAQLSRSLRQAVKNLGQELTGKGITVGVLSDSFNCNS ERNQDARYVAKNGHQDAMEDDIARGELPGNGRIRILKELRDCSDGGDEGRGMAEIIHDVA PGADIAFYTAFGGQADFAQGIEALALPKNQSTARGVPGGGAQIIVDDVEYFEEPAFQSGI IGAAIDNVVRNRGVAYFSAAGNDNADASPVAYVNNAARFADQPIDPNGTGTPGRPLNFDP SGASQVYALPVRALRQIEDTPFWRFRVQLYWDRPFDNSASSLQVCLADKNGKPFKVVVDG EPYPSCTDASVIGQQAIAWGTLLGTAAEATLQVRLLDGAAPRRLRLRTSRTVVGQFGTAD AAIYGHRLSPNSLTTGAANYLATPMCDPTLKTAQLESFSSHGGGLVLFDNDGRALARPVL DGKPDIVGPDGASSVFFGRQAKDGDRGFGVYNLNCRYYPAYPYQFLGTSAAAPHLAAVAA LMRQAVPRATPAQLYDALRKTAVDMGPPGRDNATGPGFVQPERALRELIRQAFGQSGAFP SGQ
Sequence length 663 AA
Function serine protease
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT103
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
ReferenceElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228]
AuthorElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF.
Research Group1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA
Corresponding Author  Feldman MF
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA