ProGP537

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP537
Validation Status Uncharacterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Sequence(s)
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameRSc2902
NCBI Gene ID 1221755
GenBank Gene Sequence NC_003295.1
Protein Information
Protein NameProbable lipoprotein
UniProtKB/SwissProt ID Q8XVC9
NCBI RefSeq WP_011002808.1
EMBL-CDSCAD16609.1
UniProtKB Sequence >tr|Q8XVC9|Q8XVC9_RALSO Probable lipoprotein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2902 PE=4 SV=1 MQTRLLTLAVAASLALGLAACGKQEGNPADAAKNAIQQSADAAKQAVDSASNAASQAADT AKSGVAEVASGAQAAVNAASGAMADAKDAAKDAAGKVADAAKEGADKVKEAAKQ
Sequence length 114 AA
Function Probable lipoprotein
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT103
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
ReferenceElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228]
AuthorElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF.
Research Group1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA
Corresponding Author  Feldman MF
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA