ProGP539

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP539
Validation Status Uncharacterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Sequence(s)
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameRSc1565
NCBI Gene ID 1220396
GenBank Gene Sequence NC_003295.1
Protein Information
Protein NamePeptidyl-prolyl cis-trans isomerase
UniProtKB/SwissProt ID Q8XZ41
NCBI RefSeq WP_011001509.1
EMBL-CDSCAD15267.1
UniProtKB Sequence >tr|Q8XZ41|Q8XZ41_RALSO Peptidyl-prolyl cis-trans isomerase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1565 PE=3 SV=1 MKRLSLLLCATSLALAAYNVQAASAVSAAPAESLPSGVTIQHVAKGSGPSPKATDTVKVH YRGTLADGTEFDSSYKRGQPISFPLNRVIPCWTEGVQKMQVGGKAKLTCPPATAYGARGV PGTIPPNATLNFEVELLGIGG
Sequence length 141 AA
Function PROTEIN FOLDING
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection ZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT103
Literature
Year of Identification2016
Year of Identification Month Wise2016.3.26
ReferenceElhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228]
AuthorElhenawy W1, Scott NE2, Tondo ML3, Orellano EG3, Foster LJ2, Feldman MF4.
Research Group1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Facultad de Ciencias Bioquímicas y Farmacéuticas (FBIOYF-UNR), Instituto de Biología Molecular y Celular de Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA
Corresponding Author  Feldman MF
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA