ProGP540 (Probable peptidase transmembrane protein

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP540 (Probable peptidase transmembrane protein
Validation Status Uncharacterized
Organism Information
Organism NameRalstonia solanacearum GMI1000
Domain Bacteria
Classification Family:Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 267608
Genome Information
GenBank NC_003295.1
EMBL AL646052.1
Gene Information
Gene NameRSc0352
Protein Information
Protein NameProbable peptidase transmembrane protein
UniProtKB/SwissProt ID Q8Y2I4
NCBI RefSeq CAD13880
EMBL-CDSCAD13880.1
UniProtKB Sequence >tr|Q8Y2I4|Q8Y2I4_RALSO Probable peptidase transmembrane protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc0352 PE=3 SV=1 MFIHFYVPNVRPRLMRTSLKNISLIAIGLVTGVLATLQLSATAQNATVGPLPLEKLRLMA DIFGQIKREYVEPVDDDKLLTEAIKGMVASLDPHSAYLDKKDFQELQEGTQGRFAGLGIE ISQEEGLVKVINPIEDTPAFRAGVQPGDLITRIDDKPVRGMPLEQAVKRMRGAPGTKVTL TIYRKKEERTFPLTITRAEIQVQSVKAKLLGDGIAWVRITSFQERTVPDLAKKLNDLAHQ DARLKGVILDLRNNGGGVLQAAVGVSAAFLPPDVTVVSTNGQVPDAKRVYKTSFANYRLS NFDTDPLVSLDPEFKTVPIVVLTNAYTASASEIVAGALQDHHRAKVMGKTTFGKGSVQTV RPLSNDTGIKLTIAYYYTPSGKSIQAKGIRPDVPVDQSPEGDPDDALITREIDTERHLHN KQESEEPEMTDREKRRVEELRRLEEETAKKTPEQREKERNKKPIEFGSTDDFMLQQAVAE LKGQPVKRSKSVLEAAAAVPDKATKSPAAKESSAPAKLPKGKAAPASEPAAPSGPASGVI PAPEPTGAR
Sequence length 549 AA
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS
Glycan Information
Glycan Annotation Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLRs
OST ProGT IDProGT104 (PglLRs)
Literature