ProGP545

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP545
Validation Status Uncharacterized
Organism Information
Organism NameStaphylococcus aureus strain 1061
Domain Bacteria
Classification Family:Staphylococcaceae
Order: Bacillales
Class: Bacilli
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 367830
Genome Sequence(s)
GenBank CP000255 
EMBL CP000255 
Organism Additional Information S. aureus is a human pathogen responsible for life-threatening infections as it is able to attach to surfaces, form biofilms, and persist inside the host. It causes mild skin infections and even serious and life-threatening infections, such as endocarditis, osteomyelitis, pneumonia, meningitis, and sepsis.
Gene Information
Gene Namepls
Protein Information
Protein NamePls (Plasmin sensitive surface protein)
UniProtKB/SwissProt ID P80544
EMBL-CDSAAD09131.2
UniProtKB Sequence >sp|P80544|PLS_STAAU Surface protein OS=Staphylococcus aureus GN=pls PE=1 SV=2 MNKNSKKKLDFLPNKLNKYSIRRFTVGTASILVGATLIFGVANDQAEAAENNTTQKQDDS SDASKVKGNVQTIEQSSANSNESDIPEQVDVTKDTTEQASTEEKANTTEQASTEEKADTT EQATTEEAPKAEGTDKVETEEAPKAEETDKATTEEAPKAEETDKATEEAPKTEETDKATT EEAPAAEETSKAATEEAPKAEETSKAATEEAPKAEETEKTATEEAPKTEETDKVETEEAP KAEETSKAATEKAPKAEETNKVETEEAPAAEETNKAATEETPAVEDTNAKSNSNAQPSET ERTQVVDTVAKDLYKKSEVTEAEKAEIEKVLPKDISNLSNEEIKKIALSEVLKETANKEN AQPRATFRSVSSNARTTNVNYSATALRAAAQDTVTKKGTGNFTAHGDIIHKTYKEEFPNE GTLTAFNTNFNPNTGTKGALEYNDKIDFNKDFTITVPVANNNQGNTTGADGWGFMFTQGN GQDFLNQGGILRDKGMANASGFKIDTAYNNVNGKVDKLDADKTNNLSQIGAAKVGYGTFV KNGADGVTNQVGQNALNTKDKPVNKIIYADNTTNHLDGQFHGQRLNDVVLNYDAATSTIT ATYAGKTWKATTDDLGIDKSQKYNFLITSSHMQNRYSNGIMRTNLEGVTITTPQADLIDD VEVTKQPIPHKTIREFDPTLEPGSPDVIVQKGEDGEKTTTTPTKVDPDTGDVVERGEPTT EVTKNPVDEIVHFTPEEVPQGHKDEFDPNLPIDGTEEVPGKPGIKNPETGEVVTPPVDDV TKHGPKAGEPEVTKEEIPFEKKREFNPDLKPGEEKVTQEGQTGEKTTTTPTTINPLTGEK VGEGEPTTEVTKEPVDEITQFGGEEVPQGHKDEFDPNLPIDGTEEVPGKPGIKNPETGEV VTPPVDDVTKHGPKAGEPEVTKEEIPFEKKREFNPDLKPGEEKVTQEGQTGEKTTTTPTT INPLTGEKVGEGEPTTEVTKEPVDEITQFGGEEVPQGHKDEFDPNLPIDGTEEVPGKPGI KNPETGEVVTPPVDDVTKHGPKAGEPEVTKEEIPFEKKREFNPDLKPGEEKVTQEGQTGE KTTTTPTTINPLTGEKVGEGEPTTEVTKEPVDEITQFGGEEVPQGHKDEFDPNLPIDGTE EVPGKPGIKNPETGEVVTPPVDDVTKHGPKAGEPEVTKEEIPYETKRVLDPTMEPGSPDK VAQKGENGEKTTTTPTTINPLTGEKVGEGEPTTEVTKEPIDEIVNYAPEIIPHGTREEID PNLPEGETKVIPGKDGLKDPETGEIIEEPQDEVIIHGAKDDSDADSDSDADSDSDADSDS DADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDADS DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDA DSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDA DSDSDSDSDSDSDADSDSDADSDSDSDADSDSDADSDSDADGDSDADSDSDADSDSDSDS DSDSDSDSDADSDSDSDSDSDADRDHNDKTDKPNNKELPDTGNDAQNNGTLFGSLFAALG GLFLVGRRRKNKNNEEK
Sequence length 1637 AA
Subcellular LocationSurface
Function Pls is a virulence factor that reduces the adherence of S. aureus to Fg, Fn, or endothelial cells, internalization by human host cells and phagocytosis by polymorphonuclear neutrophils (PMNs) independently of its glycosylation status.
Glycosylation Status
Glycosylation Type O- (Ser) linked
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff staining
Protein Glycosylation- Implication Biofilm formation (in S. aureus Newman) is enhanced upon expression of GtfC/GtfD-glycosylated Pls that may contribute to MRSA (methicillin-resistant S. aureus) pathogenicity. The glycoprotein may serve as a future antibacterial target to combat or prevent infections.
Glycan Information
Glycan Annotation N-acetylhexosaminyl residues
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT67, ProGT68
Characterized Accessory Gene(s)gtfC, gtfD, sdgA and sdgB
Literature
Year of Identification2017
Year of Identification Month Wise2017.01.12
ReferenceBleiziffer I, Eikmeier J, Pohlentz G, McAulay K, Xia G, Hussain M, et al. (2017) The Plasmin-Sensitive Protein Pls in Methicillin-Resistant Staphylococcus aureus (MRSA) Is a Glycoprotein. PLoS Pathog 13(1): e1006110. doi:10.1371/journal.ppat.1006110
AuthorBleiziffer I, Eikmeier J, Pohlentz G, McAulay K, Xia G, Hussain M, Peschel A, Foster S4, Peters G, Heilmann C.
Research Group1 Institute of Medical Microbiology, University of Münster, Münster, Germany. 2 Interdisciplinary Center for Clinical Research (IZKF), University of Münster, Münster, Germany. 3 Institute for Hygiene, University of Münster, Münster, Germany. 4 Department of Molecular Biology and Biotechnology, University of Sheffield, Sheffield, United Kingdom. 5 Division of Infection, Immunity and Respiratory Medicine, Faculty of Biology, Medicine and Health, University of Manchester, Manchester, United Kingdom. 6 Interfaculty Institute of Microbiology and Infection Medicine, University of Tübingen, Tübingen, Germany. 7 German Center for Infection Research (DZIF), partner site Tübingen, University of Tübingen, Tübingen, Germany. 8 Cluster of Excellence EXC 1003, Cells in Motion, University of Münster, Münster, Germany
Corresponding Author Heilmann C
Contact1 Institute of Medical Microbiology, University of Münster, Münster, Germany. 2 Interdisciplinary Center for Clinical Research (IZKF), University of Münster, Münster, Germany.