ProGP546

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP546
Validation Status Characterized
Organism Information
Organism NameEnterococcus faecalis TX0104
Domain Bacteria
Classification Family:Enterococcaceae
Order: Lactobacillales
Class: Bacilli
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 491074
Genome Sequence(s)
GenBank GG668924.1
EMBL GG668924.1
Gene Information
Gene NameHMPREF0348_0422
GenBank Gene Sequence GG668924.1
Protein Information
Protein NameHypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96
NCBI RefSeq WP_002382828
UniProtKB Sequence >tr|C0X1N7|C0X1N7_ENTFL Uncharacterized protein OS=Enterococcus faecalis TX0104 GN=HMPREF0348_0422 PE=4 SV=1 MERTKGDNTMLNKKLLENGVVNAVTIDELDAQFGGMSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDSSDPAGCNDIVRKYCK
Sequence length 83 AA
Glycosylation Status
Glycosylation Type O (Ser) and S (Cys) linked
Experimentally Validated Glycosite(s) in Full Length ProteinSer33 (Cys33 when Ser33 replaced with Cys)
Glycosite Sequence Logo
Technique(s) used for Glycosylated Residue(s) Detection LC ESI-MS, MALDI-TOF MS and tandem MS
Protein Glycosylation- Implication It is a di-glycosylated bacteriocin and active in glucosylated form only.Its antimicrobial activity affected by both nature and number of sugars attached to EC peptide affect its bioactivity against Listeria species
Glycan Information
Glycan Annotation single- and double glucosylated ( glucose and galactose
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT120
Literature
Year of Identification2017
Year of Identification Month Wise2017.05.25
Year of Validation 2017
ReferenceNagar R, Rao A (2017) An iterative glycosyltransferase EntS catalyzes transfer and extension of O- and S-linked monosaccharide in enterocin 96. Glycobiology. 2017 May 12. doi: 10.1093/glycob/cwx042
AuthorNagar R, Rao A
Research GroupCSIR-Institute of Microbial Technology, Sector 39A, Chandigarh-160036, India.
Corresponding Author Rao A
ContactCSIR-Institute of Microbial Technology, Sector 39A, Chandigarh-160036, India.