ProGP547 (Pilin A3)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP547 (Pilin A3)
Validation Status Uncharacterized
Organism Information
Organism NameHaloferax volcanii H53
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 309800
Genome Information
GenBank CP001956.1
EMBL CP001956.1
Gene Information
Gene NamepilA3 (HVO_2450)
NCBI Gene ID 8925064
GenBank Gene Sequence NC_013967.1
Protein Information
Protein NamePilin A3
UniProtKB/SwissProt ID D4GT29
NCBI RefSeq WP_004042357.1
EMBL-CDSADE02789.1
UniProtKB Sequence >tr|D4GT29|D4GT29_HALVD Pilin PilA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=pilA3 PE=4 SV=1 MNFKHLLAEDDAVSPVIGVILMVAITVILAAVIGTFVLGLGDQVGNTAPQASFGFDYNGT ALTVTHESGTSIDAAQVNITSSVALNDSAGQLAGASGTTETWESITSDSEITAGSQATVV EQNADDLSTATVRVIWTSESGSNSATLQSWSGPDA
Sequence length 155 AA
Function Structural subunit of type IV pili involved in surface adhesion
Glycosylation Status
Glycosylation Type N- (Asn) linked
Technique(s) used for Glycosylation DetectionAberrant migration on lithium dodecyl sulfate (LDS)-PAGE as detected through western blotting
Protein Glycosylation- Implication Glycosylation is crucial for pilin function. N-glycosylation of PilA3 might play a major role in the assembly and/or function of pili, and regulate the transition from planktonic cell to biofilm formation under stress conditions.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameAglB
Additional CommentPilin expression in ΔpilA[1–6] cells results in strong surface adhesion, but not microcolony formation.
Literature
Year of Identification2016
Year of Identification Month Wise2016.05
ReferenceEsquivel RN, Schulze S, Xu R, Hippler M, Pohlschroder M. (2016) Identification of Haloferax volcanii Pilin N-Glycans with Diverse Roles in Pilus Biosynthesis, Adhesion, and Microcolony Formation. J Biol Chem., 291(20), 10602-14. [PubMed: 26966177]
AuthorEsquivel RN, Schulze S, Xu R, Hippler M, Pohlschroder M.
Research Group1 Department of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104. 2 Institute of Plant Biology and Biotechnology, University of Münster, Münster 48143, Germany. 3 Department of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104.
Corresponding Author Pohlschroder M.
ContactDepartment of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104.