ProGP549 (Pilin A6)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP549 (Pilin A6)
Validation Status Uncharacterized
Organism Information
Organism NameHaloferax volcanii H53
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 309800
Genome Information
GenBank CP001955.1
EMBL CP001955.1
Gene Information
Gene NamepilA6 (HVO_A0633)
NCBI Gene ID 8923526
GenBank Gene Sequence NC_013966.1
Protein Information
Protein NamePilin A6
UniProtKB/SwissProt ID D4GRU1
NCBI RefSeq WP_004040986.1
EMBL-CDSADE02056.1
UniProtKB Sequence >tr|D4GRU1|D4GRU1_HALVD Pilin PilA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=pilA6 PE=4 SV=1 MQIKTMFTESRAVSPVIGVILMVAITVILAAVIGTFVLGLGDQVGDTAPQASFTFDYDGT ELTITHESGAQIDGDLVTIAGDVNVTDSSDANKWSTLGSDTISAGESVVVQDTDEDGFAN GDTVRVVWTSESGSNSATLQRWTYNA
Sequence length 146 AA
Function Structural subunit of type IV pili involved in surface adhesion
Glycosylation Status
Glycosylation Type N- (Asn) linked
ProGP Web Logo
Technique(s) used for Glycosylation DetectionAberrant migration on lithium dodecyl sulfate (LDS)-PAGE as detected through western blotting
Protein Glycosylation- Implication N-glycosylation may regulate the transition from planktonic cell to biofilm formation under stress conditions.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameAglB
Additional CommentPilin expression in ΔpilA[1–6]ΔaglB stimulates microcolony formation.
Literature
Year of Identification2016
Year of Identification Month Wise2016.05
ReferenceEsquivel RN, Schulze S, Xu R, Hippler M, Pohlschroder M. (2016) Identification of Haloferax volcanii Pilin N-Glycans with Diverse Roles in Pilus Biosynthesis, Adhesion, and Microcolony Formation. J Biol Chem., 291(20), 10602-14. [PubMed: 26966177]
AuthorEsquivel RN, Schulze S, Xu R, Hippler M, Pohlschroder M.
Research Group1 Department of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104. 2 Institute of Plant Biology and Biotechnology, University of Münster, Münster 48143, Germany. 3 Department of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104.
Corresponding Author Pohlschroder M.
ContactDepartment of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104.