ProGP56

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP56
Validation Status Uncharacterized
Organism Information
Organism NameClostridium thermocellum ATCC 27405
Domain Bacteria
Classification Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 203119
Genome Sequence(s)
GenBank CP000568.1
EMBL CP000568
Gene Information
Gene NamecipA (Cthe_3077)
NCBI Gene ID 4809951
GenBank Gene Sequence 4809951
Protein Information
Protein NameCellulolosome complex (Cellulosomal-scaffolding protein A)
UniProtKB/SwissProt ID Q06851
NCBI RefSeq YP_001039466.1
EMBL-CDSABN54273.1
UniProtKB Sequence >sp|Q06851|CIPA_CLOTH Cellulosomal-scaffolding protein A OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=cipA PE=1 SV=2 MRKVISMLLVVAMLTTIFAAMIPQTVSAATMTVEIGKVTAAVGSKVEIPITLKGVPSKGM ANCDFVLGYDPNVLEVTEVKPGSIIKDPDPSKSFDSAIYPDRKMIVFLFAEDSGRGTYAI TQDGVFATIVATVKSAAAAPITLLEVGAFADNDLVEISTTFVAGGVNLGSSVPTTQPNVP SDGVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVD PNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVG GFADNDLVEQKVSFIDGGVNVGNATPTKGATPTNTATPTKSATATPTRPSVPTNTPTNTP ANTPVSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTF WCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRF AKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPGGSVVPSTQPVTTPPATT KPPATTKPPATTIPPSDDPNAIKIKVDTVNAKPGDTVNIPVRFSGIPSKGIANCDFVYSY DPNVLEIIEIKPGELIVDPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATI VAKVKSGAPNGLSVIKFVEVGGFANNDLVEQRTQFFDGGVNVGDTTVPTTPTTPVTTPTD DSNAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIV DPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKF VEVGGFANNDLVEQKTQFFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDTVNAK PGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIVDPNPDKSFDTAVYPD RKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKFVEVGGFANNDLVEQK TQFFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIP SKGIANCDFVYSYDPNVLEIIEIEPGDIIVDPNPDKSFDTAVYPDRKIIVFLFAEDSGTG AYAITKDGVFATIVAKVKEGAPNGLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGDTTE PATPTTPVTTPTTTDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDP NVLEIIEIEPGELIVDPNPTKSFDTAVYPDRKMIVFLFAEDSGTGAYAITEDGVFATIVA KVKSGAPNGLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGDTTEPATPTTPVTTPTTTD DLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIV DPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKEGAPNGLSVIKF VEVGGFANNDLVEQKTQFFDGGVNVGDTTVPTTSPTTTPPEPTITPNKLTLKIGRAEGRP GDTVEIPVNLYGVPQKGIASGDFVVSYDPNVLEIIEIEPGELIVDPNPTKSFDTAVYPDR KMIVFLFAEDSGTGAYAITEDGVFATIVAKVKEGAPEGFSAIEISEFGAFADNDLVEVET DLINGGVLVTNKPVIEGYKVSGYILPDFSFDATVAPLVKAGFKVEIVGTELYAVTDANGY FEITGVPANASGYTLKISRATYLDRVIANVVVTGDTSVSTSQAPIMMWVGDIVKDNSINL LDVAEVIRCFNATKGSANYVEELDINRNGAINMQDIMIVHKHFGATSSDYDAQ
Sequence length 1853 AA
Subcellular LocationSecreted (Cell surface)
Function Cellulose-binding, multicellulase-containing protein complex, termed the cellulosome, which displays endo-glucanase and glucohydrolase activity and mediates strong adherence of the bacterium to the insoluble substrate. Also called cellulose-interacting protein A.
Glycosylation Status
Glycosylation Type O(Thr)-linked
Glycosite Sequence Logo
Glycan Information
Glycan Annotation Linkage: Gal→Thr. Gal as the major component, Glc, GlcNAc, and an unknown monosaccharide residue were detected. The total carbohydrate content was 6.8% (w/w). Tetrasaccharide is a component of the S1 subunit of the cellulosome (from SDS-PAGE experiments).
BCSDB ID123549, 123550, 123551, 123552, 123553, 135527, 135528, 136865, 136867, 136868, 136869, 136870, 136871
Literature
Year of Identification1989
Year of Identification Month Wise1989.12
Reference1) Bayer EA, Shoham Y, Lamed R (2000) The Cellulosome. An Extracellular Organelle for Degrading Plant Cell Wall Polysaccharides. In: Doyle RJ (ed) Glycomicrobiology.
AuthorBayer EA 1 , Shoham Y 2 , Lamed R 3
Research Group1 Department of Biological Chemistry, The Weizmann Institute of Science, Rehovot 76100 Israel 2 Department of Food Engineering and Biotechnology, Technion – Israel Institute of Technology, Haifa 32000 Israel 3 Department of Molecular Microbiology and Biotechnology, George S. Wise Faculty of Life Sciences, Tel Aviv University, Ramat Aviv 69978 Israel
Corresponding Author Lamed R
ContactDepartment of Molecular Microbiology and Biotechnology, George S. Wise Faculty of Life Sciences, Tel Aviv University, Ramat Aviv 69978 Israel