ProGP58

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP58
Validation Status Characterized
Organism Information
Organism NameSulfolobus acidocaldarius (DSM 639)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 2285
Genome Sequence(s)
GenBank CP000077.1
EMBL CP000077
Gene Information
Gene NamethpS (Saci_1714)
NCBI Gene ID 3474479
GenBank Gene Sequence 3474479
Protein Information
Protein NameThermopsin
UniProtKB/SwissProt ID P17118
NCBI RefSeq YP_256313.1
EMBL-CDSAAY81020.1
UniProtKB Sequence >sp|P17118|THPS_SULAC Thermopsin OS=Sulfolobus acidocaldarius GN=thpS PE=1 SV=1 MNFKSICLIILLSALIIPYIPQNIYFFPHRNTTGATISSGLYVNPYLYYTSPPAPAGIAS FGLYNYSGNVTPYVITTNEMLGYVNITSLLAYNREALRYGVDPYSATLQFNIVLSVNTSN GVYAYWLQDVGQFQTNKNSLTFIDNVWNLTGSLSTLSSSAITGNGQVASAGGGQTFYYDV GPSYTYSFPLSYIYIINMSYTSNAVYVWIGYEIIQIGQTEYGTVNYYDKITIYQPNIISA SLMINGNNYTPNGLYYDAELVWGGGGNGAPTSFNSLNCTLGLYYISNGSITPVPSLYTFG ADTAEAAYNVYTTMNNGVPIAYNGIENLTILTNNFSVILI
Sequence length 340 AA
Subcellular LocationSecreted
Function Thermostable acid protease. It has maximal proteolytic activity at pH 2 and 90 “C.Belongs to the peptidase A5 family. EC= 3.4.23.42.
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-28, Propeptide: 28-41) N65, N69
Experimentally Validated Glycosite(s ) in Mature ProteinN24, N28
Glycosite(s) Annotated Protein Sequence >sp|P17118|THPS_SULAC Thermopsin OS=Sulfolobus acidocaldarius GN=thpS PE=1 SV=1 MNFKSICLIILLSALIIPYIPQNIYFFPHRNTTGATISSGLYVNPYLYYTSPPAPAGIAS FGLYN*(65)YSGN*(69)VTPYVITTNEMLGYVNITSLLAYNREALRYGVDPYSATLQFNIVLSVNTSN GVYAYWLQDVGQFQTNKNSLTFIDNVWNLTGSLSTLSSSAITGNGQVASAGGGQTFYYDV GPSYTYSFPLSYIYIINMSYTSNAVYVWIGYEIIQIGQTEYGTVNYYDKITIYQPNIISA SLMINGNNYTPNGLYYDAELVWGGGGNGAPTSFNSLNCTLGLYYISNGSITPVPSLYTFG ADTAEAAYNVYTTMNNGVPIAYNGIENLTILTNNFSVILI
Sequence Around Glycosites (21 AA) PAGIASFGLYNYSGNVTPYVI
ASFGLYNYSGNVTPYVITTNE
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionAberrant SDS-PAGE migration.
Technique(s) used for Glycosylated Residue(s) Detection Edman degradation
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameConserved membrane protein
OST ProGT IDPro GT 52
Literature
Year of Identification1990
Year of Identification Month Wise1990.01.01
Year of Validation 1990
Reference1) Lin, X. and Tang, J. (1990) Purification, characterization, and gene cloning of thermopsin, a thermostable acid protease from Sulfolobus acidocaldarius. J Biol Chem, 265, 1490-1495. [PubMed: 2104843]
AuthorLin, X. and Tang, J.
Research GroupLaboratory of Protein Studies, Oklahoma Medical Research Foundation, Oklahoma City.
Corresponding Author Tang, J.
ContactLaboratory of Protein Studies, Oklahoma Medical Research Foundation, Oklahoma City.