ProGP603 (ABC transporter substrate binding protei

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP603 (ABC transporter substrate binding protei
Validation Status Uncharacterized
Organism Information
Organism NamePyrobaculum calidifontis JCM 11548
Domain Archaea
Classification Family:Thermoproteaceae
Order: Thermoproteales
Class:Thermoprotei
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 410359
Genome Information
GenBank CP000561.1
EMBL CP000561
Organism Additional Information Pyrobaculum calidifontis is a hyperthermophilic archaeon that belongs to the phylum Crenarchaeota. In contrast to the phylum Euryarchaeota, only the N-glycan structure of the genus Sulfolobus is known in Crenarchaeota.
Gene Information
Gene NamePcal_2112
Protein Information
Protein NameABC transporter substrate-binding protein
UniProtKB/SwissProt ID A3MY10
NCBI RefSeq ABO09527.1.
EMBL-CDSABO09527.1.
UniProtKB Sequence >tr|A3MY10|A3MY10_PYRCJ Carbohydrate ABC transporter substrate-binding protein, CUT1 family OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_2112 PE=4 SV=1 MKTSQLLAIVVLVVVVGVVAYILGTMQQAPQVTQTAPTPPAQTTAQVKKISFYTWWAGLE RFAIDAVIGNFTKKTGIQVEKTAVPGGAGVNAKFAILALMQAGNPPAAFQVHCGPEILSY IYVAPKGEASFVELSSVAKEIDMTTQAPDVLSACSLNGKVYALPVNIHRANLIFINKQVL DKIGGSVPKSLDDLVALCNKATSMGIPCLLQAGADQFTILHLWEQVFLAVAGPQKFIIFT YGTLPPDDPSLRQATEVFLTLSKTFPANWPSLDWTGAVADLVAGKGLAHVDGDWVVGLIY NVYPQVKMCPYTAVTPDCNIIVAPFPGTQGIYNLVIDAVAVPAGSPTTQMGIEFVKYFAG PEGQSIFNPLKGSIAVYKNIDPAIYPTPIQRWEVEEYRNAKAYVFSLTHGALFSDVWQSL LQQSIVLVQTGRTDLWYNTLASALNTERSLWKDTWYMGAPGKPFGGYQPPWVK
Sequence length 473 AA
Function Carbohydrate ABC transporter substrate- binding protein, CUT1 family
Glycosylation Status
Glycosylation Type N- (Asn) linked
Technique(s) used for Glycosylation DetectionConA(Concanavalin A) lectin affinity chromatography , and detected by periodic acid-Schiff (PAS) staining and Coomassie Brilliant Blue (CBB) staining on sodium dodecyl sulphate?polyacrylamide gel electrophoresis (SDS?PAGE) gels
Technique(s) used for Glycosylated Residue(s) Detection Normal-phase-HPLC-MS/MS analysis
Glycan Information
Glycan Annotation Pentasaccharide (α-Man-(1-3)-(α-Man-(1-6)-)α-Man-(1-4)-β-GlcANAc3NAc-(1-4)-β-GlcNAc3NAc)
Literature
Year of Identification2017
Year of Validation 2017