ProGP624 (Branched chain amino acid ABC transporte

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP624 (Branched chain amino acid ABC transporte
Validation Status Uncharacterized
Organism Information
Organism NamePyrobaculum calidifontis JCM 11548
Domain Archaea
Classification Family:Thermoproteaceae
Order: Thermoproteales
Class:Thermoprotei
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 410359
Genome Information
GenBank CP000561.1
EMBL CP000561
Organism Additional Information Pyrobaculum calidifontis is a hyperthermophilic archaeon that belongs to the phylum Crenarchaeota. In contrast to the phylum Euryarchaeota, only the N-glycan structure of the genus Sulfolobus is known in Crenarchaeota.
Gene Information
Gene NamePcal_0825
Protein Information
Protein NameBranched-chain amino acid ABC transporter substrate binding protein
UniProtKB/SwissProt ID A3MUD4
NCBI RefSeq ABO08251.1.
EMBL-CDSABO08251.1.
UniProtKB Sequence >tr|A3MUD4|A3MUD4_PYRCJ Amino acid/amide ABC transporter substrate-binding protein, HAAT family OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_0825 PE=4 SV=1 MYISAEDKVARGTPPPQTPPQGYLTPVIVNVQPTQAQTVVEIGVLQPLSGRLASLGELAA AAARLAEQDVNAYLTKINATFRVRVVVADTAADPTKALDQMKALHSRGIKFYIVRTSGEV RAMKSYADENKLLVISVSSTAPALAIPGDYVFRLPPDDTKQVKAISKVLQDDGIKAVVVI WRNDDWGNGLVKGLEDMAKSRGFEVIRASSYDPQKGEFSTEVSVLAQKVKDVVAKYGADK VAVAAFGFAELQTIFITAKNYPELAQVRWYGADGSTGLSELLVPAAAEFAVKVGGFVSPK FAPARSVYYDRVRNYILSEYKREPDSYAYNAYDAVWLITYSILQAGSADSERVWQVFPQV AAKYFGASGYTKLNEAGDRESGDYEIWAIVKS
Sequence length 392 AA
Function Amino acid/amide ABC transporter substrate-binding protein, HAAT family
Glycosylation Status
Glycosylation Type N- (Asn) linked
Technique(s) used for Glycosylation DetectionConA(Concanavalin A) lectin affinity chromatography , and detected by periodic acid-Schiff (PAS) staining and Coomassie Brilliant Blue (CBB) staining on sodium dodecyl sulphate?polyacrylamide gel electrophoresis (SDS?PAGE) gels
Technique(s) used for Glycosylated Residue(s) Detection Normal-phase-HPLC-MS/MS analysis
Glycan Information
Glycan Annotation Pentasaccharide (α-Man-(1-3)-(α-Man-(1-6)-)α-Man-(1-4)-β-GlcANAc3NAc-(1-4)-β-GlcNAc3NAc)
Literature
Year of Identification2017
Year of Validation 2017