ProGP657

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP657
Validation Status Uncharacterized
Organism Information
Organism NamePyrobaculum calidifontis JCM 11548
Domain Archaea
Classification Family:Thermoproteaceae
Order: Thermoproteales
Class:Thermoprotei
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 410359
Genome Sequence(s)
GenBank CP000561.1
EMBL CP000561
Organism Additional Information Pyrobaculum calidifontis is a hyperthermophilic archaeon that belongs to the phylum Crenarchaeota. In contrast to the phylum Euryarchaeota, only the N-glycan structure of the genus Sulfolobus is known in Crenarchaeota.
Gene Information
Gene NamePcal_0247
Protein Information
Protein Nameprotein-disulfide isomerase-like protein
UniProtKB/SwissProt ID A3MSR7
NCBI RefSeq ABO07684.1.
EMBL-CDSABO07684.1.
UniProtKB Sequence >tr|A3MSR7|A3MSR7_PYRCJ Protein-disulfide isomerase-like protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_0247 PE=4 SV=1 MRLVNLAIVVVVVLMVAVAVLLVAPLISQSPPQPPQVVNPGGLPIPPWAMRFGNGSAPVV LVEFFDLLCPYCAYAHVELGPLIKEKVQEGKLYYILVDFPVHGDAAWALHQPLHCAYNEL GPSATLDLVNKLYYVWYLAAIKRAISESDALANMSKTLQPYACRFNVTLAQAMGVSDAFG KVGIKIRGTPTFIIYKNGTLTVVEGAYVDKIRQLLSG
Sequence length 217 AA
Function Protein-disulfide isomerase-like protein
Glycosylation Status
Glycosylation Type N- (Asn) linked
Technique(s) used for Glycosylation DetectionConA(Concanavalin A) lectin affinity chromatography , and detected by periodic acid-Schiff (PAS) staining and Coomassie Brilliant Blue (CBB) staining on sodium dodecyl sulphate–polyacrylamide gel electrophoresis (SDS–PAGE) gels, NMR spectroscopy
Technique(s) used for Glycosylated Residue(s) Detection Normal-phase-HPLC-MS/MS analysis , LC-ESI-MS/MS analysis
Glycan Information
Glycan Annotation Pentasaccharide (α-Man-(1-3)-(α-Man-(1-6)-)α-Man-(1-4)-β-GlcANAc3NAc-(1-4)-β-GlcNAc3NAc)
Literature
Year of Identification2017
Year of Validation 2017
ReferenceFujinami D, Taguchi Y, Kohda D.(2017) Asn-linked oligosaccharide chain of a crenarchaeon, Pyrobaculum calidifontis, is reminiscent of the eukaryotic high-mannose-type glycan. Glycobiology. 2017 May 16. doi: 10.1093/glycob/cwx044.
AuthorFujinami D, Taguchi Y, Kohda D
Research Group1 Division of Structural Biology, Medical Institute of Bioregulation, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 2 Research Center for Advanced Immunology, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 3 Research Center for Live-Protein Dynamics, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan.
Corresponding Author Kohda D
Contact1 Division of Structural Biology, Medical Institute of Bioregulation, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 2 Research Center for Advanced Immunology, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 3 Research Center for Live-Protein Dynamics, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan.