ProGP682 (Flagellin)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP682 (Flagellin)
Validation Status Characterized
Organism Information
Organism NameMagnetospirillum magneticum AMB-1
Domain Bacteria
Classification Family: Rhodospirillaceae
Order: Rhodospirillales
Class: Alphaproteobacteria
Phylum:Proteobacteria
Taxonomic ID (NCBI) 342108
Genome Information
GenBank AP007255
EMBL AP007255
Gene Information
Gene Namefla (amb0684)
GenBank Gene Sequence BAE49488.1
Protein Information
Protein NameFlagellin
UniProtKB/SwissProt ID Q2W9I7
NCBI RefSeq WP_011383127.1
EMBL-CDSBAE49488.1
UniProtKB Sequence >tr|Q2W9I7|Q2W9I7_MAGSA Flagellin OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=amb0684 PE=3 SV=1 MSDVTLTSAVRSNLLALQSTQGLVNRTQSRLSTGLKVGSAIDDPVAYFQSKALSDRASDF QGKKDNIDQGVSSLSTALQGISGVSTLVKQLKGLALNAQSASSSQIGSLVQQFNALRSQL DNLALDSQYQGQNLVAGKGQTLTVSFSNLTGSTLEVTSVDVRVGATGLNIAKAVTSNGGF QLSFDDASGAALGTEGVVKATYAGTATALTSGTYTFSYGSATVSFTVYSAGGTTGANADV EAFTTTSVLANGQDFNFRATTAGDTDELNVTQGSIQNNNHFAVEYHASTGGGVSGLAGGD SLNFVMNGLTGNSLASGNYTFSFGGYNMTFTVASAGDVTAGTFTTTNTFVNGTFGTAGGV TANTLALTLSTGTGTKENVVTFTAAVSSLGATSGPYKGQAYYSAGGISGAYGFQISAETK VGYVSGQYVLDSKLTGVVQNLVTQLDANLQVLRSHAQNLGTNVALLNTRLDFTKNYVDLL QSGSGKLTLADLNEEGANLLALQTRQQLGIQALSFAGQNEKSILSLFR
Sequence length 528 AA
Subcellular LocationFlagellum
Function Flagellin is the subunit of bacterial flagella
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS103, S104, S145, S147 and T468
Glycosite(s) Annotated Protein Sequence >tr|Q2W9I7|Q2W9I7_MAGSA Flagellin OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=amb0684 PE=3 SV=1 MSDVTLTSAVRSNLLALQSTQGLVNRTQSRLSTGLKVGSAIDDPVAYFQSKALSDRASDF QGKKDNIDQGVSSLSTALQGISGVSTLVKQLKGLALNAQSASS*(103)S*(104)QIGSLVQQFNALRSQL DNLALDSQYQGQNLVAGKGQTLTVS*(145)FS*(147)NLTGSTLEVTSVDVRVGATGLNIAKAVTSNGGF QLSFDDASGAALGTEGVVKATYAGTATALTSGTYTFSYGSATVSFTVYSAGGTTGANADV EAFTTTSVLANGQDFNFRATTAGDTDELNVTQGSIQNNNHFAVEYHASTGGGVSGLAGGD SLNFVMNGLTGNSLASGNYTFSFGGYNMTFTVASAGDVTAGTFTTTNTFVNGTFGTAGGV TANTLALTLSTGTGTKENVVTFTAAVSSLGATSGPYKGQAYYSAGGISGAYGFQISAETK VGYVSGQYVLDSKLTGVVQNLVTQLDANLQVLRSHAQNLGTNVALLNT*(468)RLDFTKNYVDLL QSGSGKLTLADLNEEGANLLALQTRQQLGIQALSFAGQNEKSILSLFR
Sequence Around Glycosites (21 AA) GLALNAQSASS*SQIGSLVQQF
LALNAQSASSS*QIGSLVQQFN
VAGKGQTLTVS*FSNLTGSTLE
GKGQTLTVSFS*NLTGSTLEVT
NLGTNVALLNT*RLDFTKNYVD
Technique(s) used for Glycosylation DetectionPeriodate/biotin hydrazine method
Technique(s) used for Glycosylated Residue(s) Detection Tandem mass spectrometry (LC-MS, HCD-MS/MS))
Protein Glycosylation- Implication Flagellin glycosylation is required for export and assembly of flagellum.
Glycan Information
Glycan Annotation A nonulosonic acid sugar (most likely pseudaminic acid)
Literature
Year of Identification2018
Year of Validation 2018
ReferenceSulzenbacher G, Roig-Zamboni V, Lebrun R, Guérardel Y, Murat D, Mansuelle P, Yamakawa N, Qian XX, Vincentelli R, Bourne Y, Wu LF, Alberto F. (2018) Glycosylate and move! The glycosyltransferase Maf is involved in bacterial flagella formation.Environ Microbiol., 20(1):228-240. [PubMed: 29076618]
AuthorSulzenbacher G, Roig-Zamboni V, Lebrun R, Guérardel Y, Murat D, Mansuelle P, Yamakawa N, Qian XX, Vincentelli R, Bourne Y, Wu LF, Alberto F.
Research Group1 Aix Marseille Univ, CNRS, AFMB UMR7257, Marseille 13288, France. 2 Proteomic Platform, Institute of Microbiology of the Mediterranean, FR3479 Aix-Marseille University and National Center for Scientific Research, Marseille 13402, France. 3 Unit of Structural and Functional Glycobiology, UMR 8576 University of Lille and National Center for Scientific Research, Lille 59000, France. 4 Aix Marseille Univ, CNRS, LCB UMR7283, Marseille 13402, France. 5 International Associated Laboratory of Evolution and Development of Magnetotactic Organisms (LIA-MagMC), Centre National de la Recherche Scientifique, Marseille 13402, France.
Corresponding Author Alberto F
Contact International Associated Laboratory of Evolution and Development of Magnetotactic Organisms (LIA-MagMC), Centre National de la Recherche Scientifique, Marseille 13402, France.