ProGP78

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP78
Validation Status Uncharacterized
Organism Information
Organism NameMethanothermus sociabilis DSM3496
Domain Archaea
Classification Family: Methanothermaceae
Order: Methanobacteriales
Class: Methanobacteria or Archaeobacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2181
Genome Sequence(s)
EMBL X58296
Gene Information
Gene NameslgA
Protein Information
Protein NameCell surface glycoprotein (SlgA)
UniProtKB/SwissProt ID P27374
EMBL-CDSCAA41229.1
UniProtKB Sequence >sp|P27374|CSG_METSC Cell surface glycoprotein OS=Methanothermus sociabilis GN=slgA PE=4 SV=1 MRKFTLLMLLLIVISMSGIAGAAEVKNLNTSKTFTKIQEAIDDPSTTDGNIIIVGPGNYT ENILVNKSLTLKSNGSAIINAVSSEKSTITIKANNVWIEGFIIIGGKNGIYMENVTGCTI TNNTIQNAFVSGWEYYGGNGICLVNSTNNTITNNIIRNNTWNGINVCESKGNIIKNNTIM YSGGIGIYVWGFNKFEGNNIIENNRIINATYGGIYLFRPSNNKICRNYIANVSSGGGGMS GAICIDVSDYNIVKDNIGVNCDGGLFTDGMIGNEITNNIFKNCKVAVSESTYGPASRNNK IYGNYFINYETAISDPKGELVDNIWNTTEGGNYWSNYTGNNTGDGTGNIPYYYDNKPLVV DLAIEDIAAKPSGIEVRVKNLGKADIKKIDPLTKLKIKISCDNDVYETFIDPLSAGESQI VRWDKIVPEGNHTIKAEIPYSAEGYLIGTNIRDADISNNVFSKMVQGFVQNKTFTITLTN LGKSTITIKYYISIYTNPVNGTKVSYRELTITLKPNETKTIELGKYPFKYAVSGTMIVKN PSRYRIPLNLRIKYEIEGLNPQMREISKYMAPRGEFRYIARYTGKEEGYADVW
Sequence length 593 AA
Subcellular LocationSurface
Function Component of the surface layer.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMonosaccharide composition and detection of glycoses.
Glycan Information
Glycan Annotation Linkage: β-GalNAc-N-Asn . Glycan moieties account for about 17 mol% of the mature protein.
Literature
Year of Identification1991
Year of Identification Month Wise1991.07
Reference1) Brockl, G., Behr, M., Fabry, S., Hensel, R., Kaudewitz, H., Biendl, E. and Konig, H. (1991) Analysis and nucleotide sequence of the genes encoding the surface-layer glycoproteins of the hyperthermophilic methanogens Methanothermus fervidus and Methanothermus sociabilis. Eur J Biochem, 199, 147-152. [PubMed: 1712296]
AuthorBrockl, G., Behr, M., Fabry, S., Hensel, R., Kaudewitz, H., Biendl, E. and Konig, H
Research GroupAbteilung für Angewandte Mikrobiologie, Universität Ulm, Federal Republic of Germany.
Corresponding Author Konig, H
ContactAbteilung für Angewandte Mikrobiologie, Universität Ulm, Federal Republic of Germany.