ProGP83

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP83
Validation Status Uncharacterized
Organism Information
Organism NamePseudomonas syringae strain S203
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 321
Genome Sequence(s)
EMBL X03035
Organism Additional Information Pseudomonas syringae (Gram-negative bacterium) is phytopathogenic.
Gene Information
Gene NameinaZ
Protein Information
Protein NameIce nucleation lipoglycoprotein
UniProtKB/SwissProt ID P06620
EMBL-CDSCAA26837.1
UniProtKB Sequence >sp|P06620|ICEN_PSESY Ice nucleation protein OS=Pseudomonas syringae pv. syringae GN=inaZ PE=1 SV=1 MNLDKALVLRTCANNMADHCGLIWPASGTVESRYWQSTRRHENGLVGLLWGAGTSAFLSV HADARWIVCEVAVADIISLEEPGMVKFPRAEVVHVGDRISASHFISARQADPASTSTSTL TPMPTAIPTPMPAVASVTLPVAEQARHEVFDVASVSAAAAPVNTLPVTTPQNVQTATYGS TLSGDNHSRLIAGYGSNETAGNHSDLIAGYGSTGTAGSDSWLVAGYGSTQTAGGDSALTA GYGSTQTAREGSNLTAGYGSTGTAGSDSSLIAGYGSTQTSGGDSSLTAGYGSTQTAQEGS NLTAGYGSTGTAGSDSSLIAGYGSTQTSGGDSSLTAGYGSTQTAQEGSNLTAGYGSTGTA GVDSSLIAGYGSTQTSGSDSALTAGYGSTQTAQEGSNLTAGYGSTGTAGSDSSLIAGYGS TQTSGSDSSLTAGYGSTQTAQEGSILTAGYGSTGTAGVDSSLIAGYGSTQTSGSDSALTA GYGSTQTAQEGSNLTAGYGSTGTAGADSSLIAGYGSTQTSGSESSLTAGYGSTQTAREGS TLTAGYGSTGTAGADSSLIAGYGSTQTSGSESSLTAGYGSTQTAQQGSVLTSGYGSTQTA GAASNLTTGYGSTGTAGHESFIIAGYGSTQTAGHKSILTAGYGSTQTARDGSDLIAGYGS TGTAGSGSSLIAGYGSTQTASYRSMLTAGYGSTQTAREHSDLVTGYGSTSTAGSNSSLIA GYGSTQTAGFKSILTAGYGSTQTAQERTSLVAGYGSTSTAGYSSSLIAGYGSTQTAGYES TLTAGYGSTQTAQENSSLTTGYGSTSTAGYSSSLIAGYGSTQTAGYESTLTAGYGSTQTA QERSDLVTGYGSTSTAGYASSLIAGYGSTQTAGYESTLTAGYGSTQTAQENSSLTTGYGS TSTAGFASSLISGYGSTQTAGYKSTLTAGYGSTQTAEYGSSLTAGYGSTATAGQDSSLIA GYGSSLTSGIRSFLTAGYGSTLIAGLRSVLIAGYGSSLTSGVRSTLTAGYGSNQIASYGS SLIAGHESIQVAGNKSMLIAGKGSSQTAGFRSTLIAGAGSVQLAGDRSRLIAGADSNQTA GDRSKLLAGNNSYLTAGDRSKLTGGHDCTLMAGDQSRLTAGKNSVLTAGARSKLIGSEGS TLSAGEDSILIFRLWDGKRYRQLVARTGENGVEADIPYYVNEDDDIVDKPDEDDDWIEVK
Sequence length 1200 AA
Subcellular LocationOuter membrane
Function It helps in nucleating ice formation in supercooled water.
Protein Structure
PDB ID 1INA, 1INB
Glycosylation Status
Glycosylation Type N(Asn), O(Ser/Thr)-linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionEnzyme treatment, deglycosylation (O- and N- glycans).
Glycan Information
Glycan Annotation Linkages: Man-N-Asn, Gal-O-Ser, Gal-O-Thr.
Literature
Year of Identification1991
Year of Identification Month Wise1991.11
Reference1) Kozloff, L.M., Turner, M.A. and Arellano, F. (1991) Formation of bacterial membrane ice-nucleating lipoglycoprotein complexes. J Bacteriol, 173, 6528-6536. [PubMed: 1917877]
2) Turner, M.A., Arellano, F. and Kozloff, L.M. (1991) Components of ice nucleation structures of bacteria. J Bacteriol, 173, 6515-6527. [PubMed: 1917876]
Author Arellano, F.
Research GroupDepartment of Microbiology, University of California, San Francisco 
Corresponding Author Kozloff, L.M., Turner, M.A. Arellano, F.