ProGP96

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP96
Validation Status Uncharacterized
Organism Information
Organism NameCorynebacterium glutamicum (Brevibacterium flavum)
Domain Bacteria
Classification Family: Corynebacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1718
Genome Sequence(s)
EMBL AY842007
Gene Information
Gene NamecspB
Protein Information
Protein NamePS2 (S-Layer glycoprotein)
UniProtKB/SwissProt ID Q2VRQ3
EMBL-CDSAAX43986.1
UniProtKB Sequence >tr|Q2VRQ3|Q2VRQ3_CORGL PS2 OS=Corynebacterium glutamicum GN=cspB PE=4 SV=1 MFNNRIRTAALAGAIAISTAASGVAIPAFAQETTVTTNGFNDADGSTAQPVGPVNHTEAE LRDATDATGNYLEAFQTGDIQAIVGAYVDAGEDGFDPSEQAIFEAFEAARNEATQQLAFS KDTITKTRESVNYALKVDQEATEAFLAYRNALRGAADAINPLIEAANDANRTDRAEIKDY ADLYTQTDIALETPQLAYAFQDLKALQAEVDADFEWLGEFGIDQEDANYVQRYHIPAVEA LKAEVDARVAAIEPLRADSIAKNLEAQKSDVLVRQLFLERATAQRDTLRVVEAIFATAAR YVELYESDENVNVEGDTLRNHYVALLPTLFGAAFFNIDILDDADEAAELYYLHWNTDLGT NNEDLAYAEEKREFALLTYAKVFINGIWQEEVKYVQNLDDGARAEAARVEAERLADEAYR AEQLRIAQEAADAQKAIADALAKEAENGNNSSDDKETGSSDIGSWGPFAAIAAIIAAIAA IFPFLSGIVKF
Sequence length 491 AA
Subcellular LocationSurface
Function Structural component of the surface layer.
Literature
Year of Identification1993
Year of Identification Month Wise1993.07
Reference1) Peyret, J.L., Bayan, N., Joliff, G., Gulik-Krzywicki, T., Mathieu, L., Schechter, E. and Leblon, G. (1993) Characterization of the cspB gene encoding PS2, an ordered surface-layer protein in Corynebacterium glutamicum. Mol Microbiol, 9, 97-109. [PubMed: 8412676]
Author Peyret, J.L., Bayan, N., Joliff, G., Gulik-Krzywicki, T., Mathieu, L., Schechter, E. Leblon, G.
Research GroupLaboratory of Molecular Biology of Coryne-bacteria, URA D1354 CNRS and GDR 961, University Paris-Sud, Orsay, France.
Corresponding Author Leblon, G.
ContactLaboratoire de Biologie Moléculaire des Coryné-bactéries, URA D1354 CNRS et GDR 961, Université Paris-Sud, Orsay, France.