Latest update: September 24, 2018


ProGT1.1 (WbpM)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT1.1 (WbpM)
Organism Information
Organism NamePseudomonas aeruginosa 1244
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)287
Genome Information
Gene BankNC_002516.2
Gene Information
Gene NamewbpM 
NCBI Reference SequenceAF508154
Protein information
Protein NameWbpM 
UniProtKB/ SwissProt IDQ7X3T1
NCBI Ref SeqWP_003143571.1
UniProtKB Sequence>tr|Q7X3T1|Q7X3T1_PSEAI UDP-GlcNAc C6 dehydratase OS=Pseudomonas aeruginosa GN=wbpM PE=4 SV=1 MLDNLRMKLLGLPRRYKRMLQVAADVSLVWLSLWLAFLVRLGTEDMISPFGGHAWLFIAA PLVAIPLFIRFGMYRAVMRYLGNDALIAIAKAVTISALVLSLLVYWYRSPPAVVPRSLVF NYWWLSMLLIGGLRLAMRQYFMGDWYSAVQSVPFLNRQDGLPRVAIYGAGAAGNQLVAAL RLGRAMRPVAFIDDDKQIANRVIAGLRVYTAKHIRQMIDETGAQEVLLAIPSATRARRRE ILESLEPFPLHVRSMPGFMDLASGRVKVDDLQEVDIADLLGRDSVAPRKELLERCIRGQV VMVTGAGGSIGSELCRQIMSCSPSVLILFEHSEYNLYSIHQELERRIKRESLSVNLLPIL GSVRNPERLVDVMRTWKVNTVYHAAAYKHVPIVEHNIAEGVLNNVIGTLHAVQAAVQVGV QNFVLISTDKAVRPTNVMGSTKRLAEMVLQALSNESAPVLFGDRKDVHHVNKTRFTMVRF GNVLGSSGSVIPLFREQIKRGGPVTVTHPSITRYFMTIPEAAQLVIQAGSMGQGGDVFVL DMGPPVKILELAEKMIHLSGLSVRSERSPHGDIAIEFSGLRPGEKLYEELLIGDNVNPTD HPMIMRANEEHLSWEAFKVVLEQLLAAVEKDDYSRVRQLLRETVSGYAPDGEIVDWIYRQ RRREP
EMBL CDSAAP57848.1
Sequence length665 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)1.1.1.-
Acceptor Substrate SpecificityUDP-GlcNAc
Experimental ValidationIn vivo
ProductUDP-QuiNAc
Function in Glycosylation pathway1) WbpM is a bifunctional UDP-GlcNAc C6 dehydratase/C4 reductase essential for the nucleotide precursor UDP-QuiNAc synthesis.
Additional Information1) Expression of O-antigen biosynthesis cluster of Escherichia coli O157:H7 in strain P. aeruginosa 1244 resulted in the production of pilin that contained both the endogenous Pseudomonas as well as the Escherichia O157 O-antigens. 
Litrature
Year Of Validation2002 
Reference DiGiandomenico, A., Matewish, M. J., Bisaillon, A., Stehle, J. R., Lam, J. S., & Castric, P. (2002). Glycosylation of Pseudomonas aeruginosa 1244 pilin: glycan substrate specificity. Molecular microbiology, 46(2), 519-530.

Authors DiGiandomenico, A., Matewish, M. J., Bisaillon, A., Stehle, J. R., Lam, J. S., & Castric, P.
Research groupsDepartment of Biological Sciences, Duquesne University, Pittsburg, PA 15282, USA.
Corresponding Author Castric, P.
ContactsDepartment of Biological Sciences, Duquesne University, Pittsburg, PA 15282, USA.
Reference Horzempa J, Dean CR, Goldberg JB, Castric P. Pseudomonas aeruginosa 1244 pilin glycosylation: glycan substrate recognition. Journal of bacteriology. 2006 Jun 15;188(12):4244-52.

Authors Horzempa J, Dean CR, Goldberg JB, Castric P
Research groups1 Department of Biological Sciences, Duquesne University, 600 Forbes Ave., Pittsburgh, PA 15282, USA.
Corresponding AuthorCastric P
Contacts1 Department of Biological Sciences, Duquesne University, 600 Forbes Ave., Pittsburgh, PA 15282, USA.