Latest update: September 24, 2018


ProGT1.2 (WbpL)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT1.2 (WbpL)
ProGT Pathway
Organism Information
Organism NamePseudomonas aeruginosa 1244
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)287
Genome Information
Gene Information
Gene NamewbpL 
NCBI Reference SequenceAAM21928.1
Protein information
Protein NameWbpL 
UniProtKB/ SwissProt IDQ8KHQ7
UniProtKB Sequence>tr|Q8KHQ7|Q8KHQ7_PSEAI Serotype 07 putative O-antigen biosynthesis gene cluster, partial sequence OS=Pseudomonas aeruginosa GN=wbpL PE=4 SV=1 MNQWIIEMFFFLILAVISVSCAGTWLLRRYALARSIIDVPNARSSHSVPTPRGGGVAIVI SYLALLPVLVALDVVTAPLAIALGGGAAIALLGFLDDHGHIAARWRLLGHFSAAGWGLFW LGGFPALKFIGIHIEAGWVLNSLAALYVVWMLNLYNFMDGIDGIASVEAITACTLASLIF WGVGQQQLLIAPLFLAAAVAGFLIWNFPPAKIFMGDAGSGFLGITLAVLSMHAAWVSMDF FWSWLILLGVFVTDATVTLIRRLMRGEKVYEAHRSHAYQFAARRFGQHLPVTLFVGAINI VWLAPIAWSVARGLLPGELGVVIAYLPLVFLAVRYRAGQMEHIIAR
EMBL CDSAAM21928.1.
Sequence length346 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosylation Information
Sugar Donor SpecificityUDP-FucNAc 
Acceptor Substrate SpecificityUndPP
Experimental ValidationIn vivo
ProductUndPP-FucNAc
Donor SpecificityUDP-FucNAc
Function in Glycosylation pathway1) WbpL, a bifunctional glycosyltransferase, is required for the initiation of both LPS and O antigen synthesis.
2) WbpL involved in the initiation of the assembly of individual O?antigen units by the transfer of FucNAc from UDP?FucNAc to undecaprenol phosphate.
Additional Information1) Expression of O-antigen biosynthesis cluster of Escherichia coli O157:H7 in strain P. aeruginosa 1244 resulted in the production of pilin that contained both the endogenous Pseudomonas as well as the Escherichia O157 O-antigens. 
Litrature
Year Of Validation2002 
Reference DiGiandomenico, A., Matewish, M. J., Bisaillon, A., Stehle, J. R., Lam, J. S., & Castric, P. (2002). Glycosylation of Pseudomonas aeruginosa 1244 pilin: glycan substrate specificity. Molecular microbiology, 46(2), 519-530.

Authors DiGiandomenico, A., Matewish, M. J., Bisaillon, A., Stehle, J. R., Lam, J. S., & Castric, P.
Research groupsDepartment of Biological Sciences, Duquesne University, Pittsburg, PA 15282, USA.
Corresponding Author Castric, P.
ContactsDepartment of Biological Sciences, Duquesne University, Pittsburg, PA 15282, USA.