Latest update: September 24, 2018


ProGT10.10 (PseB)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.10 (PseB)
ProGT Pathway
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepseB 
NCBI Gene ID905585
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePseB 
UniProtKB/ SwissProt IDQ0P8W4
NCBI Ref SeqWP_002858028.1.
UniProtKB Sequence>sp|Q0P8W4|PSEB_CAMJE UDP-N-acetylglucosamine 4,6-dehydratase (inverting) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pseB PE=1 SV=1 MFNKKNILITGGTGSFGKTYTKVLLENYKPNKIIIYSRDELKQFEMASVFNAPCMRYFIG DVRDKERLSAAMRDVDFVIHAAAMKHVPIAEYNPMECIKTNIHGAQNVIDACFENGVKKC IALSTDKACNPVNLYGATKLASDKLFVAANNIAGNKQTRFGVTRYGNVVGSRGSVVPFFK KLISEGAKELPITDTRMTRFWISLEDGVKFVLSNFERMHGGEIFIPKIPSMKITDLAHAL APNLSHKIIGIRAGEKLHEIMISSDDSHLTYEFENYYAISPSIKFVDKDNDFSINALGEK GQKVKDGFSYSSDNNPLWASEKELLEIINHTEGF
EMBL CDSCAL35407.1.
Sequence length334 AA
String192222.Cj1293.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)4.2.1.115
Experimental ValidationIn vitro
Function in Glycosylation pathway1) It is a C6 dehydratase/C5 epimerase responsible for conversion of UDP-alpha-d-GlcNAc to UDP-2-acetamido-2,6-dideoxy-beta-l-arabino-4-hexulose.
Litrature
Year Of Validation2006 
Reference Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M. (2005). Functional characterization of dehydratase/aminotransferase pairs from Helicobacter and Campylobacter: enzymes distinguishing the pseudaminic acid and bacillosamine biosynthetic pathways. Journal of Biological Chemistry.

Authors Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M.
Research groupsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada.
Corresponding Author Logan, S. M.
ContactsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada.